diff --git a/go.mod b/go.mod index 9726884fe..c3cef2a29 100644 --- a/go.mod +++ b/go.mod @@ -12,8 +12,8 @@ require ( k8s.io/apimachinery v0.34.3 k8s.io/client-go v0.34.3 k8s.io/klog/v2 v2.130.1 - kmodules.xyz/client-go v0.34.3 - kmodules.xyz/resource-metadata v0.46.1 + kmodules.xyz/client-go v0.34.7-0.20260916091548-45e2a0e7782d + kmodules.xyz/resource-metadata v0.49.1-0.20260916091615-a7e699f904a2 sigs.k8s.io/controller-runtime v0.22.4 ) @@ -105,20 +105,20 @@ require ( go.uber.org/zap v1.27.0 // indirect go.yaml.in/yaml/v2 v2.4.3 // indirect go.yaml.in/yaml/v3 v3.0.4 // indirect - golang.org/x/crypto v0.52.0 // indirect - golang.org/x/net v0.55.0 // indirect - golang.org/x/oauth2 v0.33.0 // indirect - golang.org/x/sync v0.20.0 // indirect - golang.org/x/sys v0.45.0 // indirect - golang.org/x/term v0.43.0 // indirect - golang.org/x/text v0.37.0 // indirect + golang.org/x/crypto v0.55.0 // indirect + golang.org/x/net v0.57.0 // indirect + golang.org/x/oauth2 v0.36.0 // indirect + golang.org/x/sync v0.22.0 // indirect + golang.org/x/sys v0.47.0 // indirect + golang.org/x/term v0.45.0 // indirect + golang.org/x/text v0.41.0 // indirect golang.org/x/time v0.14.0 // indirect gomodules.xyz/encoding v0.0.8 // indirect gomodules.xyz/jsonpatch/v2 v2.5.0 // indirect gomodules.xyz/mergo v0.3.13 // indirect gomodules.xyz/pointer v0.1.0 // indirect - gomodules.xyz/x v0.0.17 // indirect - google.golang.org/protobuf v1.36.10 // indirect + gomodules.xyz/x v0.0.18 // indirect + google.golang.org/protobuf v1.36.11 // indirect gopkg.in/evanphx/json-patch.v4 v4.13.0 // indirect gopkg.in/inf.v0 v0.9.1 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect diff --git a/go.sum b/go.sum index 542887a23..980299109 100644 --- a/go.sum +++ b/go.sum @@ -246,8 +246,8 @@ go.yaml.in/yaml/v3 v3.0.4/go.mod h1:DhzuOOF2ATzADvBadXxruRBLzYTpT36CKvDb3+aBEFg= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= -golang.org/x/crypto v0.52.0 h1:RMs7fP2rXdep0CftQlK8Uf+kibLm7qkCcradZWYz988= -golang.org/x/crypto v0.52.0/go.mod h1:1QgfPxDqh0T2M/elOJtp9RvuR95kVjir0e6/BvEmGbc= +golang.org/x/crypto v0.55.0 h1:+KWHjbgOaAQ66dh/YlkZKHlz9ZUlq61AFirAR9ntP8M= +golang.org/x/crypto v0.55.0/go.mod h1:uq0V9dE/fzQuJtbnL+2EhWOE63vo164FY8xqEnV9xis= golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= @@ -255,28 +255,28 @@ golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20200226121028-0de0cce0169b/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20201021035429-f5854403a974/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU= -golang.org/x/net v0.55.0 h1:bcvxaJn3e1U6InsFWt1JUq1aSjnRxLzT2rtD2KfkDF8= -golang.org/x/net v0.55.0/go.mod h1:L5U2KuzuOe1lY7Z+aWVIKK6qEeJXnXV9yzGA+WCHJww= -golang.org/x/oauth2 v0.33.0 h1:4Q+qn+E5z8gPRJfmRy7C2gGG3T4jIprK6aSYgTXGRpo= -golang.org/x/oauth2 v0.33.0/go.mod h1:lzm5WQJQwKZ3nwavOZ3IS5Aulzxi68dUSgRHujetwEA= +golang.org/x/net v0.57.0 h1:K5+3DljvIuDG9/Jv9rvyMywYNFCQ9RSUY6OOTTkT+tE= +golang.org/x/net v0.57.0/go.mod h1:KpXc8iv+r3XplLAG/f7Jsf9RPszJzdR0f58q9vGOuEU= +golang.org/x/oauth2 v0.36.0 h1:peZ/1z27fi9hUOFCAZaHyrpWG5lwe0RJEEEeH0ThlIs= +golang.org/x/oauth2 v0.36.0/go.mod h1:YDBUJMTkDnJS+A4BP4eZBjCqtokkg1hODuPjwiGPO7Q= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.20.0 h1:e0PTpb7pjO8GAtTs2dQ6jYa5BWYlMuX047Dco/pItO4= -golang.org/x/sync v0.20.0/go.mod h1:9xrNwdLfx4jkKbNva9FpL6vEN7evnE43NNNJQ2LF3+0= +golang.org/x/sync v0.22.0 h1:SZjpbeLmrCk4xhRSZFNZW5gFUeCeFgjekvI/+gfScek= +golang.org/x/sync v0.22.0/go.mod h1:9xrNwdLfx4jkKbNva9FpL6vEN7evnE43NNNJQ2LF3+0= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.45.0 h1:dO4czNzziLiiXplLQgBCEpCvXQ3dnkn0SdaZSYdQ+FY= -golang.org/x/sys v0.45.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw= -golang.org/x/term v0.43.0 h1:S4RLU2sB31O/NCl+zFN9Aru9A/Cq2aqKpTZJ6B+DwT4= -golang.org/x/term v0.43.0/go.mod h1:lrhlHNdQJHO+1qVYiHfFKVuVioJIheAc3fBSMFYEIsk= +golang.org/x/sys v0.47.0 h1:o7XGOvZQCADBQQ4Y7VNq2dRWQR7JmOUW8Kxx4ZsNgWs= +golang.org/x/sys v0.47.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw= +golang.org/x/term v0.45.0 h1:NwWyBmoJCbfTHpxrWoZ9C6/VxOf7ic219I8xZZFdrf0= +golang.org/x/term v0.45.0/go.mod h1:9aqxs0blBcrm/n0L9QW0aRVD+ktan8ssZromtqJC43w= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.37.0 h1:Cqjiwd9eSg8e0QAkyCaQTNHFIIzWtidPahFWR83rTrc= -golang.org/x/text v0.37.0/go.mod h1:a5sjxXGs9hsn/AJVwuElvCAo9v8QYLzvavO5z2PiM38= +golang.org/x/text v0.41.0 h1:vz/seA0lnX87Othu2f/0L24RcgrXD9/YFTSuGjj3rH8= +golang.org/x/text v0.41.0/go.mod h1:jvf1O8ajNzZqhSrQBPbutR/EB83Cc0CFrezNQIwbb5M= golang.org/x/time v0.14.0 h1:MRx4UaLrDotUKUdCIqzPC48t1Y9hANFKIRpNx+Te8PI= golang.org/x/time v0.14.0/go.mod h1:eL/Oa2bBBK0TkX57Fyni+NgnyQQN4LitPmob2Hjnqw4= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= @@ -284,8 +284,8 @@ golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtn golang.org/x/tools v0.0.0-20200619180055-7c47624df98f/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE= golang.org/x/tools v0.0.0-20201211185031-d93e913c1a58/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= -golang.org/x/tools v0.44.0 h1:UP4ajHPIcuMjT1GqzDWRlalUEoY+uzoZKnhOjbIPD2c= -golang.org/x/tools v0.44.0/go.mod h1:KA0AfVErSdxRZIsOVipbv3rQhVXTnlU6UhKxHd1seDI= +golang.org/x/tools v0.48.0 h1:3+hClM1aLL5mjMKm5ovokw9epgRXPuu2tILgismM6RE= +golang.org/x/tools v0.48.0/go.mod h1:08xX0orndb/F7jJxGDicx061tyd5pcMto75YMAXr6lk= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -302,10 +302,10 @@ gomodules.xyz/pointer v0.1.0 h1:sG2UKrYVSo6E3r4itAjXfPfe4fuXMi0KdyTHpR3vGCg= gomodules.xyz/pointer v0.1.0/go.mod h1:sPLsC0+yLTRecUiC5yVlyvXhZ6LAGojNCRWNNqoplvo= gomodules.xyz/testing v0.0.4 h1:XGKt4B64mBe7P9kPR0Rz1nCQpWoSpBEFdTGkfU1RLe4= gomodules.xyz/testing v0.0.4/go.mod h1:hD6aXtv9eVycPwS01zv+QTl5BrK2DXQgr6bHqnrW+44= -gomodules.xyz/x v0.0.17 h1:Ik3wf0suCMiYPY0miFUh+q8BpjsUHc/7zvANbFViBQA= -gomodules.xyz/x v0.0.17/go.mod h1:7R5182LvgWj1ZGlnpbhfSLsxM3lFN7LBettztpX+A2I= -google.golang.org/protobuf v1.36.10 h1:AYd7cD/uASjIL6Q9LiTjz8JLcrh/88q5UObnmY3aOOE= -google.golang.org/protobuf v1.36.10/go.mod h1:HTf+CrKn2C3g5S8VImy6tdcUvCska2kB7j23XfzDpco= +gomodules.xyz/x v0.0.18 h1:Hm4YKg32VYJmFOKpV4mLIPXEpkDFVIso3AhJC/ME9oc= +gomodules.xyz/x v0.0.18/go.mod h1:lhsalLjQeL2ce489fu7xEVcR5nowKgltuvnXLGgUAdc= +google.golang.org/protobuf v1.36.11 h1:fV6ZwhNocDyBLK0dj+fg8ektcVegBBuEolpbTQyBNVE= +google.golang.org/protobuf v1.36.11/go.mod h1:HTf+CrKn2C3g5S8VImy6tdcUvCska2kB7j23XfzDpco= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= @@ -345,14 +345,14 @@ k8s.io/utils v0.0.0-20251002143259-bc988d571ff4 h1:SjGebBtkBqHFOli+05xYbK8YF1Dzk k8s.io/utils v0.0.0-20251002143259-bc988d571ff4/go.mod h1:OLgZIPagt7ERELqWJFomSt595RzquPNLL48iOWgYOg0= kmodules.xyz/apiversion v0.2.0 h1:vAQYqZFm4xu4pbB1cAdHbFEPES6EQkcR4wc06xdTOWk= kmodules.xyz/apiversion v0.2.0/go.mod h1:oPX8g8LvlPdPX3Yc5YvCzJHQnw3YF/X4/jdW0b1am80= -kmodules.xyz/client-go v0.34.3 h1:2K2Tjwwy62QOpgIpuRB0STDAt2e7omkKt06oC8YV+/U= -kmodules.xyz/client-go v0.34.3/go.mod h1:myCt7AfRao4PBdUtKXu01xxbqqmLZ5U8fW0LQDaifhQ= +kmodules.xyz/client-go v0.34.7-0.20260916091548-45e2a0e7782d h1:p/L/Dr9BYQuUXCW3yA/yArcLvQvJwE3SCXRyiGy/VUY= +kmodules.xyz/client-go v0.34.7-0.20260916091548-45e2a0e7782d/go.mod h1:B955bkfn4K+yxJ9hDQxybGDIiVRzalTZGYsLdtxVQ5w= kmodules.xyz/go-containerregistry v0.0.15 h1:PRY5FDOzb6u23KOulQ4SWNdeUkBKmezLyJXP88q4EPw= kmodules.xyz/go-containerregistry v0.0.15/go.mod h1:rO0DEbYYEu1BfVcZ1pXV+3RgzVXr/k5hXcO+BQYVVDI= kmodules.xyz/offshoot-api v0.34.0 h1:HnOOp8FrCjTWjtNApRDo6Ahe79tOlLrJmyye4xxO4Kk= kmodules.xyz/offshoot-api v0.34.0/go.mod h1:F+B59yYw4CZJ4uD4xu6C+mMLzIXUtuH7E+SbDICl9jE= -kmodules.xyz/resource-metadata v0.46.1 h1:mm4sWZvQMFJJiLdKlPGxD9Cj6f44SCdHB7CsbkZXnb8= -kmodules.xyz/resource-metadata v0.46.1/go.mod h1:ejz7IVjhqmj6VH8CVfprocJK/IM++OeunrfUp51ZrIw= +kmodules.xyz/resource-metadata v0.49.1-0.20260916091615-a7e699f904a2 h1:st8Ufhp5/mdrPBbPI9aOFuzWWzxM58ycSWY+ZRIpDRk= +kmodules.xyz/resource-metadata v0.49.1-0.20260916091615-a7e699f904a2/go.mod h1:feZ7UFQKMNWk+WjnxbztQoCNnH6DXQMvt/y/HAXiehE= kmodules.xyz/resource-metrics v0.34.0 h1:cqscgTx3PONxHj6PIySK3sTlKKv8iKTGzRd+S6YSwXg= kmodules.xyz/resource-metrics v0.34.0/go.mod h1:R34IKtp5+NqcQz7AQJheBJK6Iem0LqrCbm/55Mn+ECQ= moul.io/http2curl/v2 v2.3.1-0.20221024080105-10c404f653f7 h1:NykkTlRB+X40z86cLHdEmuoTxhNKhQebLT379b1EumA= diff --git a/lib/billing_event.go b/lib/billing_event.go index b17a1f3d3..ca10f21e4 100644 --- a/lib/billing_event.go +++ b/lib/billing_event.go @@ -51,6 +51,13 @@ func (p *BillingEventCreator) CreateEvent(obj client.Object) (*api.Event, error) return nil, err } + if p.ClusterMetadata != nil && p.ClusterMetadata.License != nil && p.ClusterMetadata.License.OrgID != "" { + res.Spec.Tenant = &corev1alpha1.TenantInfo{ + OrgID: p.ClusterMetadata.License.OrgID, + Source: corev1alpha1.TenantSourceCluster, + } + } + if p.NamespaceLister != nil { var ns core.Namespace err = p.NamespaceLister.Get(context.TODO(), client.ObjectKey{Name: obj.GetNamespace()}, &ns) @@ -64,15 +71,22 @@ func (p *BillingEventCreator) CreateEvent(obj client.Object) (*api.Event, error) } res.Spec.Namespace.EnableResourceTrial = ns.Annotations[kmapi.AceEnableResourceTrialKey] == "true" if ns.Labels[kmapi.ClientOrgKey] == "true" { - res.Spec.Namespace.AceOrgID = ns.Annotations[kmapi.AceOrgIDKey] - orgMetadata := map[string]string{} for k, v := range ns.Annotations { if after, found := strings.CutPrefix(k, kmapi.ClientKeyPrefix); found { orgMetadata[after] = v } } - res.Spec.Namespace.AceOrgMetadata = orgMetadata + // a client org is more specific than the cluster it sits on + res.Spec.Tenant = &corev1alpha1.TenantInfo{ + OrgID: ns.Annotations[kmapi.AceOrgIDKey], + Metadata: orgMetadata, + Source: corev1alpha1.TenantSourceNamespace, + } + + // Deprecated: kept one release for consumers not yet reading Tenant + res.Spec.Namespace.AceOrgID = ns.Annotations[kmapi.AceOrgIDKey] // nolint:staticcheck + res.Spec.Namespace.AceOrgMetadata = orgMetadata // nolint:staticcheck } // ensure cluster mode is always up-to-date diff --git a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go index 8d99551fe..b1da45687 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (!amd64 && !loong64 && !ppc64le && !ppc64 && !s390x) || !gc || purego +//go:build (!amd64 && !loong64 && !ppc64le && !ppc64 && !riscv64 && !s390x) || !gc || purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go index 315b84ac3..55041bf51 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gc && !purego && (amd64 || loong64 || ppc64 || ppc64le) +//go:build gc && !purego && (amd64 || loong64 || ppc64 || ppc64le || riscv64) package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_riscv64.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_riscv64.s new file mode 100644 index 000000000..ce5eb3d43 --- /dev/null +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_riscv64.s @@ -0,0 +1,158 @@ +// Copyright 2026 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc && !purego + +#define LOAD64U(base, offset, t0, t1, t2, t3, dst) \ + MOVBU (offset+0*1)(base), t0; \ + MOVBU (offset+1*1)(base), t1; \ + MOVBU (offset+2*1)(base), t2; \ + MOVBU (offset+3*1)(base), t3; \ + SLL $8, t1; \ + SLL $16, t2; \ + SLL $24, t3; \ + OR t1, t0; \ + OR t3, t2; \ + OR t2, t0, dst; \ + MOVBU (offset+4*1)(base), t0; \ + MOVBU (offset+5*1)(base), t1; \ + MOVBU (offset+6*1)(base), t2; \ + MOVBU (offset+7*1)(base), t3; \ + SLL $32, t0; \ + SLL $40, t1; \ + SLL $48, t2; \ + SLL $56, t3; \ + OR t1, t0; \ + OR t3, t2; \ + OR t2, t0; \ + OR t0, dst + +// func update(state *macState, msg []byte) +TEXT ·update(SB), $0-32 + MOV state+0(FP), X5 + MOV msg_base+8(FP), X6 + MOV msg_len+16(FP), X7 + + MOV $16, X8 + + AND $7, X6, X28 + + MOV (0*8)(X5), X9 // h0 + MOV (1*8)(X5), X10 // h1 + MOV (2*8)(X5), X11 // h2 + MOV (3*8)(X5), X12 // r0 + MOV (4*8)(X5), X13 // r1 + + BLT X7, X8, tail + +loop: + BEQZ X28, aligned_load + + LOAD64U(X6, 0*8, X16, X18, X19, X20, X15) // msg[0:8] + LOAD64U(X6, 1*8, X16, X18, X19, X20, X17) // msg[8:16] + JMP block + +aligned_load: + MOV (0*8)(X6), X15 // msg[0:8] + MOV (1*8)(X6), X17 // msg[8:16] + +block: + ADD X15, X9 // h0 (x1 + y1 = z1', if z1' < x1 then z1' overflow) + SLTU X15, X9, X19 // h0.carry + ADD X17, X10, X22 + SLTU X17, X22, X23 + ADD X22, X19, X10 // h1 + SLTU X22, X10, X19 + OR X23, X19 // h1.carry + ADD $1, X19 + ADD X19, X11 // h2 + + ADD $16, X6 // msg = msg[16:] + +multiply: + MULHU X9, X12, X16 // h0r0.hi + MUL X9, X12, X15 // h0r0.lo + MULHU X10, X12, X17 // h1r0.hi + MUL X10, X12, X14 // h1r0.lo + ADD X14, X16 + SLTU X14, X16, X19 + ADD X19, X17 + MUL X11, X12, X20 + ADD X17, X20 + MULHU X9, X13, X17 // h0r1.hi + MUL X9, X13, X14 // h0r1.lo + ADD X14, X16 + SLTU X14, X16, X19 + ADD X19, X17 + MOV X17, X9 + MUL X11, X13, X21 // h2r1 + MULHU X10, X13, X17 // h1r1.hi + MUL X10, X13, X14 // h1r1.lo + ADD X14, X20 + ADD X17, X21, X22 + SLTU X14, X20, X19 + ADD X22, X19, X21 + ADD X9, X20 + SLTU X9, X20, X19 + ADD X19, X21 + AND $3, X20, X11 + AND $-4, X20, X18 + ADD X18, X15, X9 + ADD X21, X16, X22 + SLTU X18, X9, X19 + SLTU X21, X22, X23 + ADD X22, X19, X10 + SLTU X22, X10, X19 + OR X19, X23, X19 + ADD X19, X11 + SLL $62, X21, X22 + SRL $2, X20, X23 + SRL $2, X21, X21 + OR X22, X23, X20 + ADD X20, X9, X9 + ADD X21, X10, X22 + SLTU X20, X9, X19 + SLTU X21, X22, X23 + ADD X22, X19, X10 + SLTU X22, X10, X19 + OR X19, X23, X19 + ADD X19, X11, X11 + + SUB $16, X7, X7 + BGE X7, X8, loop + +tail: + BEQ X7, X0, done + MOV $1, X15 + MOV $0, X16 + ADD X7, X6, X6 + +flush_buffer: + MOVBU -1(X6), X20 + SRL $56, X15, X19 + SLL $8, X16, X23 + SLL $8, X15, X15 + OR X19, X23, X16 + XOR X20, X15 + SUB $1, X7, X7 + SUB $1, X6, X6 + BNE X7, X0, flush_buffer + + ADD X15, X9 + SLTU X15, X9, X19 + ADD X16, X10, X22 + SLTU X16, X22, X23 + ADD X22, X19, X10 + SLTU X22, X10, X19 + OR X23, X19 + ADD X19, X11 + + MOV $16, X7 + JMP multiply + +done: + MOV X9, (0*8)(X5) // h0 + MOV X10, (1*8)(X5) + MOV X11, (2*8)(X5) + RET diff --git a/vendor/golang.org/x/net/http2/server_wrap.go b/vendor/golang.org/x/net/http2/server_wrap.go index a7a09551c..737f1f057 100644 --- a/vendor/golang.org/x/net/http2/server_wrap.go +++ b/vendor/golang.org/x/net/http2/server_wrap.go @@ -10,9 +10,11 @@ package http2 import ( "context" + "crypto/tls" "errors" "net" "net/http" + "slices" "sync" "time" ) @@ -44,6 +46,20 @@ func configureServer(s *http.Server, conf *Server) error { h2.IdleTimeout = h1.ReadTimeout } } + + // Register h2 and http/1.1 ALPN protocols on s.TLSConfig, matching + // the pre-wrapping implementation in server.go, so that TLS listeners + // built from s.TLSConfig still negotiate HTTP/2. + if s.TLSConfig == nil { + s.TLSConfig = new(tls.Config) + } + if !slices.Contains(s.TLSConfig.NextProtos, NextProtoTLS) { + s.TLSConfig.NextProtos = append(s.TLSConfig.NextProtos, NextProtoTLS) + } + if !slices.Contains(s.TLSConfig.NextProtos, "http/1.1") { + s.TLSConfig.NextProtos = append(s.TLSConfig.NextProtos, "http/1.1") + } + conf.state = &serverInternalState{ s1: s, } diff --git a/vendor/golang.org/x/net/http2/transport_wrap.go b/vendor/golang.org/x/net/http2/transport_wrap.go index d25d99bdb..534e77ab9 100644 --- a/vendor/golang.org/x/net/http2/transport_wrap.go +++ b/vendor/golang.org/x/net/http2/transport_wrap.go @@ -22,8 +22,8 @@ import ( ) func configureTransport(t1 *http.Transport) error { - // ConfigureTransport is a no-op: The http.Transport already supports HTTP/2. - return nil + _, err := configureTransports(t1) + return err } func configureTransports(t1 *http.Transport) (*Transport, error) { @@ -31,6 +31,17 @@ func configureTransports(t1 *http.Transport) (*Transport, error) { // linked to the http.Transport's. tr2 := &Transport{} tr2.configure(t1) + // Enable HTTP/2 on the transport, as the pre-wrapping implementation did: + // net/http does not auto-enable it for a transport with a custom + // TLSClientConfig or dialer. + if t1.TLSClientConfig == nil { + t1.TLSClientConfig = &tls.Config{} + } + if t1.Protocols == nil { + t1.Protocols = new(http.Protocols) + t1.Protocols.SetHTTP1(true) + } + t1.Protocols.SetHTTP2(true) return tr2, nil } @@ -44,7 +55,7 @@ type transportConfig struct { // Registered is called by net/http.Transport.RegisterProtocol, // to let us know that it understands the registration mechanism we're using. func (t transportConfig) Registered(t1 *http.Transport) { - t.t.t1 = t1 + t.t.lazyt1 = t1 } func (t transportConfig) DisableCompression() bool { @@ -134,29 +145,30 @@ func (t transportConfig) DialFromContext(ctx context.Context, network, address s type transportInternal struct { initOnce sync.Once - t1 *http.Transport + lazyt1 *http.Transport } -func (t *Transport) init() { +func (t *Transport) init() *http.Transport { t.initOnce.Do(func() { - if t.t1 != nil { + if t.lazyt1 != nil { return } t1 := &http.Transport{} t.configure(t1) }) + return t.lazyt1 } func (t *Transport) configure(t1 *http.Transport) { t1.RegisterProtocol("http/2", transportConfig{t}) - // tr2.t1 is set by transportConfig.Registered. - if t.t1 != t1 { + // tr2.lazyt1 is set by transportConfig.Registered. + if t.lazyt1 != t1 { panic("http2: net/http does not support this version of x/net/http2") } } func (t *Transport) roundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Response, error) { - t.init() + t1 := t.init() if req.URL.Scheme == "http" && !t.AllowHTTP { return nil, errors.New("http2: unencrypted HTTP/2 not enabled") @@ -177,22 +189,23 @@ func (t *Transport) roundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res ctx := context.WithValue(req.Context(), http2TransportContextKey{}, t) req = req.WithContext(ctx) - return t.t1.RoundTrip(req) + return t1.RoundTrip(req) } func (t *Transport) closeIdleConnections() { - t.init() - t.t1.CloseIdleConnections() + t1 := t.init() + t1.CloseIdleConnections() } func (t *Transport) newUserClientConn(c net.Conn) (*ClientConn, error) { + t1 := t.init() // http.Transport's NewClientConn doesn't provide a supported way to create // a connection from a net.Conn. (This might be useful to add in the future?) // We're going to craftily sneak one in via the context key, with the // scheme of "http/2" telling NewClientConn to look for it. ctx := context.WithValue(context.Background(), netConnContextKey{}, c) - nhcc, err := t.t1.NewClientConn(ctx, "http/2", "") + nhcc, err := t1.NewClientConn(ctx, "http/2", "") if err != nil { return nil, err } diff --git a/vendor/golang.org/x/net/idna/idna.go b/vendor/golang.org/x/net/idna/idna.go index 22767125b..e2f28fed4 100644 --- a/vendor/golang.org/x/net/idna/idna.go +++ b/vendor/golang.org/x/net/idna/idna.go @@ -400,7 +400,11 @@ func (p *Profile) process(s string, toASCII bool) (string, error) { // Spec says keep the old label. continue } - if unicode16 && err == nil && len(u) > 0 && isASCII(u) { + if err == nil && len(u) > 0 && isASCII(u) { + // UTS 43 pre-revision 33 doesn't classify a xn-- label + // which contains only ASCII characters as an error, + // but that's a specification bug and a security issue. + // Always return an error in this case. err = punyError(enc) } isBidi = isBidi || bidirule.DirectionString(u) != bidi.LeftToRight diff --git a/vendor/golang.org/x/sync/errgroup/errgroup.go b/vendor/golang.org/x/sync/errgroup/errgroup.go index f69fd7546..c261a8ebb 100644 --- a/vendor/golang.org/x/sync/errgroup/errgroup.go +++ b/vendor/golang.org/x/sync/errgroup/errgroup.go @@ -109,7 +109,7 @@ func (g *Group) TryGo(f func() error) bool { if g.sem != nil { select { case g.sem <- token{}: - // Note: this allows barging iff channels in general allow barging. + // Note: this allows barging if and only if channels in general allow barging. default: return false } diff --git a/vendor/golang.org/x/sys/cpu/parse.go b/vendor/golang.org/x/sys/cpu/parse.go index 56a7e1a17..12a99af5c 100644 --- a/vendor/golang.org/x/sys/cpu/parse.go +++ b/vendor/golang.org/x/sys/cpu/parse.go @@ -6,38 +6,50 @@ package cpu import "strconv" -// parseRelease parses a dot-separated version number. It follows the semver -// syntax, but allows the minor and patch versions to be elided. +// parseRelease parses a dot-separated version number from the prefix +// of rel. It returns ok=true only if at least the major and minor +// components were successfully parsed; the patch component is +// best-effort. Trailing vendor or build suffixes such as +// "-generic", "+", "_hi3535", or "-rc1" are ignored. // // This is a copy of the Go runtime's parseRelease from -// https://golang.org/cl/209597. +// https://golang.org/cl/209597, updated in https://golang.org/cl/781800. func parseRelease(rel string) (major, minor, patch int, ok bool) { - // Strip anything after a dash or plus. - for i := range len(rel) { - if rel[i] == '-' || rel[i] == '+' { - rel = rel[:i] - break + // next consumes a run of decimal digits from the front of rel, + // returning the parsed value. If the digits are followed by a + // '.', it is consumed and more is set so the caller knows to + // parse another component; otherwise scanning terminates and + // the rest of rel is discarded. + next := func() (n int, more, ok bool) { + i := 0 + for i < len(rel) && rel[i] >= '0' && rel[i] <= '9' { + i++ } - } - - next := func() (int, bool) { - for i := range len(rel) { - if rel[i] == '.' { - ver, err := strconv.Atoi(rel[:i]) - rel = rel[i+1:] - return ver, err == nil - } + if i == 0 { + return 0, false, false + } + n, err := strconv.Atoi(rel[:i]) + if err != nil { + return 0, false, false + } + if i < len(rel) && rel[i] == '.' { + rel = rel[i+1:] + return n, true, true } - ver, err := strconv.Atoi(rel) rel = "" - return ver, err == nil + return n, false, true + } + + var more bool + if major, more, ok = next(); !ok || !more { + return 0, 0, 0, false } - if major, ok = next(); !ok || rel == "" { - return + if minor, more, ok = next(); !ok { + return 0, 0, 0, false } - if minor, ok = next(); !ok || rel == "" { - return + if !more { + return major, minor, 0, true } - patch, ok = next() - return + patch, _, _ = next() + return major, minor, patch, true } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index ce4d7ab1e..21e2bfa39 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1874,6 +1874,7 @@ func Dup2(oldfd, newfd int) error { //sys Dup3(oldfd int, newfd int, flags int) (err error) //sysnb EpollCreate1(flag int) (fd int, err error) //sysnb EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) +//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT //sys Eventfd(initval uint, flags int) (fd int, err error) = SYS_EVENTFD2 //sys Exit(code int) = SYS_EXIT_GROUP //sys Fallocate(fd int, mode uint32, off int64, len int64) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go index 506dafa7b..210d545c9 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go @@ -20,7 +20,6 @@ func setTimeval(sec, usec int64) Timeval { // 64-bit file system and 32-bit uid calls // (386 default is 32-bit file system and 16-bit uid). -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64_64 //sys Fchown(fd int, uid int, gid int) (err error) = SYS_FCHOWN32 //sys Fstat(fd int, stat *Stat_t) (err error) = SYS_FSTAT64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go index d557cf8de..a9a52f231 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go @@ -6,7 +6,6 @@ package unix -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go index ecf92bfa2..54474c20f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go @@ -44,7 +44,6 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) { // 64-bit file system and 32-bit uid calls // (16-bit uid calls are not always supported in newer kernels) -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fchown(fd int, uid int, gid int) (err error) = SYS_FCHOWN32 //sys Fstat(fd int, stat *Stat_t) (err error) = SYS_FSTAT64 //sys Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) = SYS_FSTATAT64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go index 173738077..e9f30db97 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go @@ -8,7 +8,6 @@ package unix import "unsafe" -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index a3fd1d0b8..6f09ca200 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -8,7 +8,6 @@ package unix import "unsafe" -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstatfs(fd int, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go index 70963a95a..ca3b56597 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go @@ -6,7 +6,6 @@ package unix -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstatfs(fd int, buf *Statfs_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go index c218ebd28..54ba667b1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go @@ -13,7 +13,6 @@ import ( func Syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno) -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Ftruncate(fd int, length int64) (err error) = SYS_FTRUNCATE64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go index e6c48500c..ce4628590 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go @@ -11,7 +11,6 @@ import ( "unsafe" ) -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) = SYS_FSTAT64 //sys Fstatat(dirfd int, path string, stat *Stat_t, flags int) (err error) = SYS_FSTATAT64 diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go index 7286a9aa8..33f7af380 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go @@ -6,7 +6,6 @@ package unix -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index fc5543c5f..c658871e3 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -8,7 +8,6 @@ package unix import "unsafe" -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go index 66f31210d..2c8587691 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go @@ -10,7 +10,6 @@ import ( "unsafe" ) -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go index 11d1f1698..4964119af 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go @@ -6,7 +6,6 @@ package unix -//sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) //sys Fstat(fd int, stat *Stat_t) (err error) diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index 9d72a6b73..5bb51d7ae 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -1359,6 +1359,7 @@ const ( FAN_UNLIMITED_MARKS = 0x20 FAN_UNLIMITED_QUEUE = 0x10 FD_CLOEXEC = 0x1 + FD_PIDFS_ROOT = -0x2712 FD_SETSIZE = 0x400 FF0 = 0x0 FIB_RULE_DEV_DETACHED = 0x8 @@ -1970,6 +1971,8 @@ const ( MADV_DONTNEED = 0x4 MADV_DONTNEED_LOCKED = 0x18 MADV_FREE = 0x8 + MADV_GUARD_INSTALL = 0x66 + MADV_GUARD_REMOVE = 0x67 MADV_HUGEPAGE = 0xe MADV_HWPOISON = 0x64 MADV_KEEPONFORK = 0x13 @@ -2114,7 +2117,7 @@ const ( MS_NOSEC = 0x10000000 MS_NOSUID = 0x2 MS_NOSYMFOLLOW = 0x100 - MS_NOUSER = -0x80000000 + MS_NOUSER = 0x80000000 MS_POSIXACL = 0x10000 MS_PRIVATE = 0x40000 MS_RDONLY = 0x1 @@ -3786,6 +3789,9 @@ const ( TCPOPT_TIMESTAMP = 0x8 TCPOPT_TSTAMP_HDR = 0x101080a TCPOPT_WINDOW = 0x3 + TCP_AO_KEYF_EXCLUDE_OPT = 0x2 + TCP_AO_KEYF_IFINDEX = 0x1 + TCP_AO_MAXKEYLEN = 0x50 TCP_CC_INFO = 0x1a TCP_CM_INQ = 0x24 TCP_CONGESTION = 0xd diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index 80f40e401..5788c2a58 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -700,6 +700,23 @@ func EpollCtl(epfd int, op int, fd int, event *EpollEvent) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { + var _p0 unsafe.Pointer + if len(events) > 0 { + _p0 = unsafe.Pointer(&events[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := Syscall6(SYS_EPOLL_PWAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Eventfd(initval uint, flags int) (fd int, err error) { r0, _, e1 := Syscall(SYS_EVENTFD2, uintptr(initval), uintptr(flags), 0) fd = int(r0) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go index 4def3e9fc..254f33988 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64_64, uintptr(fd), uintptr(offset), uintptr(offset>>32), uintptr(length), uintptr(length>>32), uintptr(advice)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go index fef2bc8ba..27c05db1a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go index a9fd76a88..840d85bfc 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go @@ -213,23 +213,6 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := Syscall(SYS_FCHOWN32, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go index 460065028..fe414498b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_PWAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index c8987d264..eb358ce05 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_PWAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go index 921f43061..c437622f1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall9(SYS_FADVISE64, uintptr(fd), 0, uintptr(offset>>32), uintptr(offset), uintptr(length>>32), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go index 44f067829..bc4ca2558 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go index e7fa0abf0..5051435ce 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go index 8c5125675..33aa5418a 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall9(SYS_FADVISE64, uintptr(fd), 0, uintptr(offset), uintptr(offset>>32), uintptr(length), uintptr(length>>32), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go index 7392fd45e..3bef8ef1d 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fchown(fd int, uid int, gid int) (err error) { _, _, e1 := Syscall(SYS_FCHOWN, uintptr(fd), uintptr(uid), uintptr(gid)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go index 41180434e..fc1bd4e2c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go index 40c6ce7ae..d78fe7dab 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index 2cfe34adb..76dcf87d0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_PWAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go index 61e6f0709..2cf020f2b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go index 834b84204..527637623 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go @@ -45,23 +45,6 @@ func Tee(rfd int, wfd int, len int, flags int) (n int64, err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) { - var _p0 unsafe.Pointer - if len(events) > 0 { - _p0 = unsafe.Pointer(&events[0]) - } else { - _p0 = unsafe.Pointer(&_zero) - } - r0, _, e1 := Syscall6(SYS_EPOLL_WAIT, uintptr(epfd), uintptr(_p0), uintptr(len(events)), uintptr(msec), 0, 0) - n = int(r0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fadvise(fd int, offset int64, length int64, advice int) (err error) { _, _, e1 := Syscall6(SYS_FADVISE64, uintptr(fd), uintptr(offset), uintptr(length), uintptr(advice), 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index d11d5b96a..526a0d5f4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -6397,3 +6397,79 @@ const ( MPOL_PREFERRED_MANY = 0x5 MPOL_WEIGHTED_INTERLEAVE = 0x6 ) + +const ( + GPIO_V2_GET_LINEINFO_IOCTL = 0xc100b405 + GPIO_V2_GET_LINE_IOCTL = 0xc250b407 + GPIO_V2_LINE_GET_VALUES_IOCTL = 0xc010b40e + GPIO_V2_LINE_SET_VALUES_IOCTL = 0xc010b40f + GPIO_V2_GET_LINEINFO_WATCH_IOCTL = 0xc100b406 + GPIO_GET_LINEINFO_UNWATCH_IOCTL = 0xc004b40c +) +const ( + GPIO_V2_LINE_ATTR_ID_FLAGS = 0x1 + GPIO_V2_LINE_ATTR_ID_OUTPUT_VALUES = 0x2 + GPIO_V2_LINE_ATTR_ID_DEBOUNCE = 0x3 + GPIO_V2_LINE_CHANGED_REQUESTED = 0x1 + GPIO_V2_LINE_CHANGED_RELEASED = 0x2 + GPIO_V2_LINE_CHANGED_CONFIG = 0x3 + GPIO_V2_LINE_EVENT_RISING_EDGE = 0x1 + GPIO_V2_LINE_EVENT_FALLING_EDGE = 0x2 +) + +type GPIOChipInfo struct { + Name [32]byte + Label [32]byte + Lines uint32 +} +type GPIOV2LineValues struct { + Bits uint64 + Mask uint64 +} +type GPIOV2LineAttribute struct { + Id uint32 + _ uint32 + Flags uint64 +} +type GPIOV2LineConfigAttribute struct { + Attr GPIOV2LineAttribute + Mask uint64 +} +type GPIOV2LineConfig struct { + Flags uint64 + Num_attrs uint32 + _ [5]uint32 + Attrs [10]GPIOV2LineConfigAttribute +} +type GPIOV2LineRequest struct { + Offsets [64]uint32 + Consumer [32]byte + Config GPIOV2LineConfig + Num_lines uint32 + Event_buffer_size uint32 + _ [5]uint32 + Fd int32 +} +type GPIOV2LineInfo struct { + Name [32]byte + Consumer [32]byte + Offset uint32 + Num_attrs uint32 + Flags uint64 + Attrs [10]GPIOV2LineAttribute + _ [4]uint32 +} +type GPIOV2LineInfoChanged struct { + Info GPIOV2LineInfo + Timestamp_ns uint64 + Event_type uint32 + _ [5]uint32 +} +type GPIOV2LineEvent struct { + Timestamp_ns uint64 + Id uint32 + Offset uint32 + Seqno uint32 + Line_seqno uint32 + _ [6]uint32 +} diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 97ef790de..aede1de7f 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -711,3 +711,7 @@ type SysvShmDesc struct { _ uint32 _ uint32 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index 90b50da68..bb3bc4dc2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -725,3 +725,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index acda13685..1fdf4c517 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -705,3 +705,7 @@ type SysvShmDesc struct { _ uint32 _ uint32 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index ef7a99e1f..063e6f0b4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -704,3 +704,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 966063dfc..9cf836c70 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -705,3 +705,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index dc53b20b7..1d222fcb3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -710,3 +710,7 @@ type SysvShmDesc struct { Ctime_high uint16 _ uint16 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 9ad0aa8c3..912cc4ab6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -707,3 +707,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index 29d55493d..1e358ef34 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -707,3 +707,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index a4d9e1584..df59f32f5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -710,3 +710,7 @@ type SysvShmDesc struct { Ctime_high uint16 _ uint16 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index f8a297771..29355aa0b 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -718,3 +718,7 @@ type SysvShmDesc struct { _ uint32 _ [4]byte } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 4158d6c4e..c6083a15d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -713,3 +713,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 1035af49f..6321cc762 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -713,3 +713,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index 2297125d3..b44f402fe 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -792,3 +792,7 @@ const ( RISCV_HWPROBE_KEY_ZICBOZ_BLOCK_SIZE = 0x6 RISCV_HWPROBE_WHICH_CPUS = 0x1 ) + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 8481e9bd9..b22c795a6 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -727,3 +727,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x8044b401 +) diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index a6828a031..0b18075b5 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -708,3 +708,7 @@ type SysvShmDesc struct { _ uint64 _ uint64 } + +const ( + GPIO_GET_CHIPINFO_IOCTL = 0x4044b401 +) diff --git a/vendor/golang.org/x/sys/windows/security_windows.go b/vendor/golang.org/x/sys/windows/security_windows.go index 6c955cea1..783621561 100644 --- a/vendor/golang.org/x/sys/windows/security_windows.go +++ b/vendor/golang.org/x/sys/windows/security_windows.go @@ -1109,17 +1109,53 @@ const ( ) // This type is the union inside of TRUSTEE and must be created using one of the TrusteeValueFrom* functions. +// +// Go pointers stored in a TrusteeValue must be pinned using [runtime.Pinner] +// for the lifetime of the TrusteeValue. type TrusteeValue uintptr +// TrusteeValueFromString is unsafe and should not be used. +// +// It returns a uintptr containing a reference to newly-allocated memory +// which will be freed by the garbage collector. +// There is no way for the caller to safely reference this memory. +// +// To create a [TrusteeValue] from a string, use: +// +// p, err := windows.UTF16PtrFromString(s) +// if err != nil { +// // handle error +// } +// +// // Pin the string for as long as it is used. +// var pinner runtime.Pinner +// pinner.Pin(p) +// defer pinner.Unpin() +// +// tv := TrusteeValue(unsafe.Pointer(p)) +// +// Deprecated: TrusteeValueFromString is unsafe and should not be used. func TrusteeValueFromString(str string) TrusteeValue { return TrusteeValue(unsafe.Pointer(StringToUTF16Ptr(str))) } + +// TrusteeValueFromSID returns a [TrusteeValue] referencing sid. +// +// The caller must pin sid using a [runtime.Pinner] for the lifetime of the TrusteeValue. func TrusteeValueFromSID(sid *SID) TrusteeValue { return TrusteeValue(unsafe.Pointer(sid)) } + +// TrusteeValueFromObjectsAndSid returns a [TrusteeValue] referencing objectsAndSid. +// +// The caller must pin objectsAndSid using a [runtime.Pinner] for the lifetime of the TrusteeValue. func TrusteeValueFromObjectsAndSid(objectsAndSid *OBJECTS_AND_SID) TrusteeValue { return TrusteeValue(unsafe.Pointer(objectsAndSid)) } + +// TrusteeValueFromObjectsAndName returns a [TrusteeValue] referencing objectsAndName. +// +// The caller must pin objectsAndName using a [runtime.Pinner] for the lifetime of the TrusteeValue. func TrusteeValueFromObjectsAndName(objectsAndName *OBJECTS_AND_NAME) TrusteeValue { return TrusteeValue(unsafe.Pointer(objectsAndName)) } diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 9755bca9f..e6966b4c3 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -1728,11 +1728,15 @@ func (s *NTUnicodeString) String() string { // the more common *uint16 string type. func NewNTString(s string) (*NTString, error) { var nts NTString - s8, err := BytePtrFromString(s) + s8, err := ByteSliceFromString(s) if err != nil { return nil, err } - RtlInitString(&nts, s8) + // The source string plus its terminating NUL must fit within MAX_USHORT. + if len(s8) > MAX_USHORT { + return nil, syscall.EINVAL + } + RtlInitString(&nts, &s8[0]) return &nts, nil } diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index d2574a73e..75a50b316 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -169,6 +169,7 @@ const ( FORMAT_MESSAGE_ARGUMENT_ARRAY = 8192 FORMAT_MESSAGE_MAX_WIDTH_MASK = 255 + MAX_USHORT = 0xffff MAX_PATH = 260 MAX_LONG_PATH = 32768 diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go index e9aa9e193..a28f45d7b 100644 --- a/vendor/golang.org/x/text/cases/context.go +++ b/vendor/golang.org/x/text/cases/context.go @@ -249,7 +249,7 @@ func upper(c *context) bool { return c.copy() } -// isUpper writes the isUppercase version of the current rune to dst. +// isUpper reports whether the current rune is in upper case. func isUpper(c *context) bool { ct := c.caseType() if c.info&hasMappingMask == 0 || ct == cUpper { diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go index 0f7c6a14b..51a683092 100644 --- a/vendor/golang.org/x/text/cases/map.go +++ b/vendor/golang.org/x/text/cases/map.go @@ -774,7 +774,7 @@ func nlTitle(c *context) bool { // From CLDR: // # Special titlecasing for Dutch initial "ij". // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // # Fix up Ij at the beginning of a "word" (per Any-Title, not UAX #29) // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { return title(c) @@ -794,7 +794,7 @@ func nlTitleSpan(c *context) bool { // From CLDR: // # Special titlecasing for Dutch initial "ij". // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // # Fix up Ij at the beginning of a "word" (per Any-Title, not UAX #29) // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; if c.src[c.pSrc] != 'I' { return isTitle(c) diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index f3a234e5f..b3cf5d9bd 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -121,8 +121,12 @@ func (p Properties) BoundaryAfter() bool { // // When all 6 bits are zero, the character is inert, meaning it is never // influenced by normalization. +// +// We set flags to 0x80 (high bit 7 unused in quick check data) to indicate an invalid rune. type qcInfo uint8 +func (p Properties) isInvalid() bool { return p.flags == 0x80 } + func (p Properties) isYesC() bool { return p.flags&0x10 == 0 } func (p Properties) isYesD() bool { return p.flags&0x4 == 0 } @@ -247,6 +251,9 @@ func (f Form) PropertiesString(s string) Properties { // to a Properties. See the comment at the top of the file // for more information on the format. func compInfo(v uint16, sz int) Properties { + if sz == 0 { + return Properties{flags: 0x80, size: 1} + } if v == 0 { return Properties{size: uint8(sz)} } else if v >= 0x8000 { @@ -254,7 +261,7 @@ func compInfo(v uint16, sz int) Properties { size: uint8(sz), ccc: uint8(v), tccc: uint8(v), - flags: qcInfo(v >> 8), + flags: qcInfo(v>>8) & 0x3f, } if p.ccc > 0 || p.combinesBackward() { p.nLead = uint8(p.flags & 0x3) diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index 417c6b268..3cc059224 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -376,16 +376,12 @@ func nextComposed(i *Iter) []byte { goto doNorm } prevCC = i.info.tccc - sz := int(i.info.size) - if sz == 0 { - sz = 1 // illegal rune: copy byte-by-byte - } - p := outp + sz + p := outp + int(i.info.size) if p > len(i.buf) { break } outp = p - i.p += sz + i.p += int(i.info.size) if i.p >= i.rb.nsrc { i.setDone() break diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index 4747ad07a..60b1511ca 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -148,7 +148,7 @@ func (f Form) IsNormalString(s string) bool { // patched buffer and whether the decomposition is still in progress. func patchTail(rb *reorderBuffer) bool { info, p := lastRuneStart(&rb.f, rb.out) - if p == -1 || info.size == 0 { + if p == -1 || info.isInvalid() { return true } end := p + int(info.size) @@ -225,7 +225,7 @@ func doAppend(rb *reorderBuffer, out []byte, p int) []byte { } fd := &rb.f if doMerge { - var info Properties + info := Properties{flags: 0x80, size: 1} // invalid rune if p < n { info = fd.info(src, p) if !info.BoundaryBefore() || info.nLeadingNonStarters() > 0 { @@ -235,7 +235,7 @@ func doAppend(rb *reorderBuffer, out []byte, p int) []byte { p = decomposeSegment(rb, p, true) } } - if info.size == 0 { + if info.isInvalid() { rb.doFlush() // Append incomplete UTF-8 encoding. return src.appendSlice(rb.out, p, n) @@ -314,7 +314,7 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) continue } info := f.info(src, i) - if info.size == 0 { + if info.isInvalid() { if atEOF { // include incomplete runes return n, true @@ -379,7 +379,7 @@ func (f Form) firstBoundary(src input, nsrc int) int { // CGJ insertion points correctly. Luckily it doesn't have to. for { info := fd.info(src, i) - if info.size == 0 { + if info.isInvalid() { return -1 } if s := ss.next(info); s != ssSuccess { @@ -424,7 +424,7 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { } fd := formTable[f] info := fd.info(src, 0) - if info.size == 0 { + if info.isInvalid() { if atEOF { return 1 } @@ -435,7 +435,7 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { for i := int(info.size); i < nsrc; i += int(info.size) { info = fd.info(src, i) - if info.size == 0 { + if info.isInvalid() { if atEOF { return i } @@ -465,7 +465,7 @@ func lastBoundary(fd *formInfo, b []byte) int { if p == -1 { return -1 } - if info.size == 0 { // ends with incomplete rune + if info.isInvalid() { // ends with incomplete rune if p == 0 { // starts with incomplete rune return -1 } @@ -504,7 +504,7 @@ func lastBoundary(fd *formInfo, b []byte) int { func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { // Force one character to be consumed. info := rb.f.info(rb.src, sp) - if info.size == 0 { + if info.isInvalid() { return 0 } if s := rb.ss.next(info); s == ssStarter { @@ -528,7 +528,7 @@ func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { break } info = rb.f.info(rb.src, sp) - if info.size == 0 { + if info.isInvalid() { if !atEOF { return int(iShortSrc) } diff --git a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go index 669133d04..c96e44834 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go @@ -32,7 +32,7 @@ var byteType = reflect.TypeOf(byte(0)) func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescriptors) protoreflect.FieldDescriptor { f := new(filedesc.Field) f.L0.ParentFile = filedesc.SurrogateProto2 - f.L1.EditionFeatures = f.L0.ParentFile.L1.EditionFeatures + packed := false for len(tag) > 0 { i := strings.IndexByte(tag, ',') if i < 0 { @@ -108,7 +108,7 @@ func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescri f.L1.StringName.InitJSON(jsonName) } case s == "packed": - f.L1.EditionFeatures.IsPacked = true + packed = true case strings.HasPrefix(s, "def="): // The default tag is special in that everything afterwards is the // default regardless of the presence of commas. @@ -121,6 +121,13 @@ func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescri tag = strings.TrimPrefix(tag[i:], ",") } + // Update EditionFeatures after the loop and after we know whether this is + // a proto2 or proto3 field. + f.L1.EditionFeatures = f.L0.ParentFile.L1.EditionFeatures + if packed { + f.L1.EditionFeatures.IsPacked = true + } + // The generator uses the group message name instead of the field name. // We obtain the real field name by lowercasing the group name. if f.L1.Kind == protoreflect.GroupKind { diff --git a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go index 099b2bf45..9aa7a9bb7 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go @@ -424,27 +424,34 @@ func (d *Decoder) parseFieldName() (tok Token, err error) { return Token{}, d.newSyntaxError("invalid field name: %s", errId(d.in)) } -// parseTypeName parses Any type URL or extension field name. The name is -// enclosed in [ and ] characters. The C++ parser does not handle many legal URL -// strings. This implementation is more liberal and allows for the pattern -// ^[-_a-zA-Z0-9]+([./][-_a-zA-Z0-9]+)*`). Whitespaces and comments are allowed -// in between [ ], '.', '/' and the sub names. +// parseTypeName parses an Any type URL or an extension field name. The name is +// enclosed in [ and ] characters. We allow almost arbitrary type URL prefixes, +// closely following the text-format spec [1,2]. We implement "ExtensionName | +// AnyName" as follows (with some exceptions for backwards compatibility): +// +// char = [-_a-zA-Z0-9] +// url_char = char | [.~!$&'()*+,;=] | "%", hex, hex +// +// Ident = char, { char } +// TypeName = Ident, { ".", Ident } ; +// UrlPrefix = url_char, { url_char | "/" } ; +// ExtensionName = "[", TypeName, "]" ; +// AnyName = "[", UrlPrefix, "/", TypeName, "]" ; +// +// Additionally, we allow arbitrary whitespace and comments between [ and ]. +// +// [1] https://protobuf.dev/reference/protobuf/textformat-spec/#characters +// [2] https://protobuf.dev/reference/protobuf/textformat-spec/#field-names func (d *Decoder) parseTypeName() (Token, error) { - startPos := len(d.orig) - len(d.in) // Use alias s to advance first in order to use d.in for error handling. - // Caller already checks for [ as first character. + // Caller already checks for [ as first character (d.in[0] == '['). s := consume(d.in[1:], 0) if len(s) == 0 { return Token{}, ErrUnexpectedEOF } + // Collect everything between [ and ] in name. var name []byte - for len(s) > 0 && isTypeNameChar(s[0]) { - name = append(name, s[0]) - s = s[1:] - } - s = consume(s, 0) - var closed bool for len(s) > 0 && !closed { switch { @@ -452,23 +459,20 @@ func (d *Decoder) parseTypeName() (Token, error) { s = s[1:] closed = true - case s[0] == '/', s[0] == '.': - if len(name) > 0 && (name[len(name)-1] == '/' || name[len(name)-1] == '.') { - return Token{}, d.newSyntaxError("invalid type URL/extension field name: %s", - d.orig[startPos:len(d.orig)-len(s)+1]) - } + case s[0] == '/' || isTypeNameChar(s[0]) || isUrlExtraChar(s[0]): name = append(name, s[0]) - s = s[1:] - s = consume(s, 0) - for len(s) > 0 && isTypeNameChar(s[0]) { - name = append(name, s[0]) - s = s[1:] + s = consume(s[1:], 0) + + // URL percent-encoded chars + case s[0] == '%': + if len(s) < 3 || !isHexChar(s[1]) || !isHexChar(s[2]) { + return Token{}, d.parseTypeNameError(s, 3) } - s = consume(s, 0) + name = append(name, s[0], s[1], s[2]) + s = consume(s[3:], 0) default: - return Token{}, d.newSyntaxError( - "invalid type URL/extension field name: %s", d.orig[startPos:len(d.orig)-len(s)+1]) + return Token{}, d.parseTypeNameError(s, 1) } } @@ -476,15 +480,38 @@ func (d *Decoder) parseTypeName() (Token, error) { return Token{}, ErrUnexpectedEOF } - // First character cannot be '.'. Last character cannot be '.' or '/'. - size := len(name) - if size == 0 || name[0] == '.' || name[size-1] == '.' || name[size-1] == '/' { - return Token{}, d.newSyntaxError("invalid type URL/extension field name: %s", - d.orig[startPos:len(d.orig)-len(s)]) + // Split collected name on last '/' into urlPrefix and typeName (if '/' is + // present). + typeName := name + if i := bytes.LastIndexByte(name, '/'); i != -1 { + urlPrefix := name[:i] + typeName = name[i+1:] + + // urlPrefix may be empty (for backwards compatibility). + // If non-empty, it must not start with '/'. + if len(urlPrefix) > 0 && urlPrefix[0] == '/' { + return Token{}, d.parseTypeNameError(s, 0) + } } + // typeName must not be empty (note: "" splits to [""]) and all identifier + // parts must not be empty. + for _, ident := range bytes.Split(typeName, []byte{'.'}) { + if len(ident) == 0 { + return Token{}, d.parseTypeNameError(s, 0) + } + } + + // typeName must not contain any percent-encoded or special URL chars. + for _, b := range typeName { + if b == '%' || (b != '.' && isUrlExtraChar(b)) { + return Token{}, d.parseTypeNameError(s, 0) + } + } + + startPos := len(d.orig) - len(d.in) + endPos := len(d.orig) - len(s) d.in = s - endPos := len(d.orig) - len(d.in) d.consume(0) return Token{ @@ -496,16 +523,32 @@ func (d *Decoder) parseTypeName() (Token, error) { }, nil } +func (d *Decoder) parseTypeNameError(s []byte, numUnconsumedChars int) error { + return d.newSyntaxError( + "invalid type URL/extension field name: %s", + d.in[:len(d.in)-len(s)+min(numUnconsumedChars, len(s))], + ) +} + +func isHexChar(b byte) bool { + return ('0' <= b && b <= '9') || + ('a' <= b && b <= 'f') || + ('A' <= b && b <= 'F') +} + func isTypeNameChar(b byte) bool { - return (b == '-' || b == '_' || + return b == '-' || b == '_' || ('0' <= b && b <= '9') || ('a' <= b && b <= 'z') || - ('A' <= b && b <= 'Z')) + ('A' <= b && b <= 'Z') } -func isWhiteSpace(b byte) bool { +// isUrlExtraChar complements isTypeNameChar with extra characters that we allow +// in URLs but not in type names. Note that '/' is not included so that it can +// be treated specially. +func isUrlExtraChar(b byte) bool { switch b { - case ' ', '\n', '\r', '\t': + case '.', '~', '!', '$', '&', '(', ')', '*', '+', ',', ';', '=': return true default: return false diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go index dbcf90b87..c775e5832 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go @@ -32,6 +32,7 @@ const ( EditionProto3 Edition = 999 Edition2023 Edition = 1000 Edition2024 Edition = 1001 + EditionUnstable Edition = 9999 EditionUnsupported Edition = 100000 ) diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go index dd31faaeb..78f02b1b4 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go @@ -330,7 +330,6 @@ func (md *Message) unmarshalFull(b []byte, sb *strs.Builder) { md.L1.Extensions.List[extensionIdx].unmarshalFull(v, sb) extensionIdx++ case genid.DescriptorProto_Options_field_number: - md.unmarshalOptions(v) rawOptions = appendOptions(rawOptions, v) } default: @@ -356,27 +355,6 @@ func (md *Message) unmarshalFull(b []byte, sb *strs.Builder) { md.L2.Options = md.L0.ParentFile.builder.optionsUnmarshaler(&descopts.Message, rawOptions) } -func (md *Message) unmarshalOptions(b []byte) { - for len(b) > 0 { - num, typ, n := protowire.ConsumeTag(b) - b = b[n:] - switch typ { - case protowire.VarintType: - v, m := protowire.ConsumeVarint(b) - b = b[m:] - switch num { - case genid.MessageOptions_MapEntry_field_number: - md.L1.IsMapEntry = protowire.DecodeBool(v) - case genid.MessageOptions_MessageSetWireFormat_field_number: - md.L1.IsMessageSet = protowire.DecodeBool(v) - } - default: - m := protowire.ConsumeFieldValue(num, typ, b) - b = b[m:] - } - } -} - func unmarshalMessageReservedRange(b []byte) (r [2]protoreflect.FieldNumber) { for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) diff --git a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go index 950a6a325..65aaf4d21 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go @@ -26,6 +26,7 @@ const ( Edition_EDITION_PROTO3_enum_value = 999 Edition_EDITION_2023_enum_value = 1000 Edition_EDITION_2024_enum_value = 1001 + Edition_EDITION_UNSTABLE_enum_value = 9999 Edition_EDITION_1_TEST_ONLY_enum_value = 1 Edition_EDITION_2_TEST_ONLY_enum_value = 2 Edition_EDITION_99997_TEST_ONLY_enum_value = 99997 diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go index 229c69801..4a3bf393e 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go @@ -113,6 +113,9 @@ func sizeMap(mapv reflect.Value, mapi *mapInfo, f *coderFieldInfo, opts marshalO } func consumeMap(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi *mapInfo, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { + if opts.depth--; opts.depth < 0 { + return out, errRecursionDepth + } if wtyp != protowire.BytesType { return out, errUnknown } @@ -170,6 +173,9 @@ func consumeMap(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi *mapInfo } func consumeMapOfMessage(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi *mapInfo, f *coderFieldInfo, opts unmarshalOptions) (out unmarshalOutput, err error) { + if opts.depth--; opts.depth < 0 { + return out, errRecursionDepth + } if wtyp != protowire.BytesType { return out, errUnknown } diff --git a/vendor/google.golang.org/protobuf/internal/impl/decode.go b/vendor/google.golang.org/protobuf/internal/impl/decode.go index e0dd21fa5..1228b5c8c 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/decode.go +++ b/vendor/google.golang.org/protobuf/internal/impl/decode.go @@ -102,8 +102,7 @@ var errUnknown = errors.New("unknown") func (mi *MessageInfo) unmarshalPointer(b []byte, p pointer, groupTag protowire.Number, opts unmarshalOptions) (out unmarshalOutput, err error) { mi.init() - opts.depth-- - if opts.depth < 0 { + if opts.depth--; opts.depth < 0 { return out, errRecursionDepth } if flags.ProtoLegacy && mi.isMessageSet { diff --git a/vendor/google.golang.org/protobuf/internal/impl/validate.go b/vendor/google.golang.org/protobuf/internal/impl/validate.go index 7b2995dde..99a1eb95f 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/validate.go +++ b/vendor/google.golang.org/protobuf/internal/impl/validate.go @@ -68,9 +68,13 @@ func Validate(mt protoreflect.MessageType, in protoiface.UnmarshalInput) (out pr if in.Resolver == nil { in.Resolver = protoregistry.GlobalTypes } + if in.Depth == 0 { + in.Depth = protowire.DefaultRecursionLimit + } o, st := mi.validate(in.Buf, 0, unmarshalOptions{ flags: in.Flags, resolver: in.Resolver, + depth: in.Depth, }) if o.initialized { out.Flags |= protoiface.UnmarshalInitialized @@ -257,6 +261,9 @@ func (mi *MessageInfo) validate(b []byte, groupTag protowire.Number, opts unmars states[0].typ = validationTypeGroup states[0].endGroup = groupTag } + if opts.depth--; opts.depth < 0 { + return out, ValidationInvalid + } initialized := true start := len(b) State: @@ -451,6 +458,13 @@ State: mi: vi.mi, tail: b, }) + if vi.typ == validationTypeMessage || + vi.typ == validationTypeGroup || + vi.typ == validationTypeMap { + if opts.depth--; opts.depth < 0 { + return out, ValidationInvalid + } + } b = v continue State case validationTypeRepeatedVarint: @@ -499,6 +513,9 @@ State: mi: vi.mi, endGroup: num, }) + if opts.depth--; opts.depth < 0 { + return out, ValidationInvalid + } continue State case flags.ProtoLegacy && vi.typ == validationTypeMessageSetItem: typeid, v, n, err := messageset.ConsumeFieldValue(b, false) @@ -521,6 +538,13 @@ State: mi: xvi.mi, tail: b[n:], }) + if xvi.typ == validationTypeMessage || + xvi.typ == validationTypeGroup || + xvi.typ == validationTypeMap { + if opts.depth--; opts.depth < 0 { + return out, ValidationInvalid + } + } b = v continue State } @@ -547,12 +571,14 @@ State: switch st.typ { case validationTypeMessage, validationTypeGroup: numRequiredFields = int(st.mi.numRequiredFields) + opts.depth++ case validationTypeMap: // If this is a map field with a message value that contains // required fields, require that the value be present. if st.mi != nil && st.mi.numRequiredFields > 0 { numRequiredFields = 1 } + opts.depth++ } // If there are more than 64 required fields, this check will // always fail and we will report that the message is potentially diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go index 77de0f238..763fd8284 100644 --- a/vendor/google.golang.org/protobuf/internal/version/version.go +++ b/vendor/google.golang.org/protobuf/internal/version/version.go @@ -52,7 +52,7 @@ import ( const ( Major = 1 Minor = 36 - Patch = 10 + Patch = 11 PreRelease = "" ) diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go index 4cbf1aeaf..889d8511d 100644 --- a/vendor/google.golang.org/protobuf/proto/decode.go +++ b/vendor/google.golang.org/protobuf/proto/decode.go @@ -121,9 +121,8 @@ func (o UnmarshalOptions) unmarshal(b []byte, m protoreflect.Message) (out proto out, err = methods.Unmarshal(in) } else { - o.RecursionLimit-- - if o.RecursionLimit < 0 { - return out, errors.New("exceeded max recursion depth") + if o.RecursionLimit--; o.RecursionLimit < 0 { + return out, errRecursionDepth } err = o.unmarshalMessageSlow(b, m) } @@ -220,6 +219,9 @@ func (o UnmarshalOptions) unmarshalSingular(b []byte, wtyp protowire.Type, m pro } func (o UnmarshalOptions) unmarshalMap(b []byte, wtyp protowire.Type, mapv protoreflect.Map, fd protoreflect.FieldDescriptor) (n int, err error) { + if o.RecursionLimit--; o.RecursionLimit < 0 { + return 0, errRecursionDepth + } if wtyp != protowire.BytesType { return 0, errUnknown } @@ -305,3 +307,5 @@ func (o UnmarshalOptions) unmarshalMap(b []byte, wtyp protowire.Type, mapv proto var errUnknown = errors.New("BUG: internal error (unknown)") var errDecode = errors.New("cannot parse invalid wire-format data") + +var errRecursionDepth = errors.New("exceeded maximum recursion depth") diff --git a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go index 4eacb523c..0b23faa95 100644 --- a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go +++ b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go @@ -69,6 +69,8 @@ const ( // comparison. Edition_EDITION_2023 Edition = 1000 Edition_EDITION_2024 Edition = 1001 + // A placeholder edition for developing and testing unscheduled features. + Edition_EDITION_UNSTABLE Edition = 9999 // Placeholder editions for testing feature resolution. These should not be // used or relied on outside of tests. Edition_EDITION_1_TEST_ONLY Edition = 1 @@ -91,6 +93,7 @@ var ( 999: "EDITION_PROTO3", 1000: "EDITION_2023", 1001: "EDITION_2024", + 9999: "EDITION_UNSTABLE", 1: "EDITION_1_TEST_ONLY", 2: "EDITION_2_TEST_ONLY", 99997: "EDITION_99997_TEST_ONLY", @@ -105,6 +108,7 @@ var ( "EDITION_PROTO3": 999, "EDITION_2023": 1000, "EDITION_2024": 1001, + "EDITION_UNSTABLE": 9999, "EDITION_1_TEST_ONLY": 1, "EDITION_2_TEST_ONLY": 2, "EDITION_99997_TEST_ONLY": 99997, @@ -4793,11 +4797,11 @@ const file_google_protobuf_descriptor_proto_rawDesc = "" + "\x18EnumValueDescriptorProto\x12\x12\n" + "\x04name\x18\x01 \x01(\tR\x04name\x12\x16\n" + "\x06number\x18\x02 \x01(\x05R\x06number\x12;\n" + - "\aoptions\x18\x03 \x01(\v2!.google.protobuf.EnumValueOptionsR\aoptions\"\xa7\x01\n" + + "\aoptions\x18\x03 \x01(\v2!.google.protobuf.EnumValueOptionsR\aoptions\"\xb5\x01\n" + "\x16ServiceDescriptorProto\x12\x12\n" + "\x04name\x18\x01 \x01(\tR\x04name\x12>\n" + "\x06method\x18\x02 \x03(\v2&.google.protobuf.MethodDescriptorProtoR\x06method\x129\n" + - "\aoptions\x18\x03 \x01(\v2\x1f.google.protobuf.ServiceOptionsR\aoptions\"\x89\x02\n" + + "\aoptions\x18\x03 \x01(\v2\x1f.google.protobuf.ServiceOptionsR\aoptionsJ\x04\b\x04\x10\x05R\x06stream\"\x89\x02\n" + "\x15MethodDescriptorProto\x12\x12\n" + "\x04name\x18\x01 \x01(\tR\x04name\x12\x1d\n" + "\n" + @@ -5033,14 +5037,15 @@ const file_google_protobuf_descriptor_proto_rawDesc = "" + "\bSemantic\x12\b\n" + "\x04NONE\x10\x00\x12\a\n" + "\x03SET\x10\x01\x12\t\n" + - "\x05ALIAS\x10\x02*\xa7\x02\n" + + "\x05ALIAS\x10\x02*\xbe\x02\n" + "\aEdition\x12\x13\n" + "\x0fEDITION_UNKNOWN\x10\x00\x12\x13\n" + "\x0eEDITION_LEGACY\x10\x84\a\x12\x13\n" + "\x0eEDITION_PROTO2\x10\xe6\a\x12\x13\n" + "\x0eEDITION_PROTO3\x10\xe7\a\x12\x11\n" + "\fEDITION_2023\x10\xe8\a\x12\x11\n" + - "\fEDITION_2024\x10\xe9\a\x12\x17\n" + + "\fEDITION_2024\x10\xe9\a\x12\x15\n" + + "\x10EDITION_UNSTABLE\x10\x8fN\x12\x17\n" + "\x13EDITION_1_TEST_ONLY\x10\x01\x12\x17\n" + "\x13EDITION_2_TEST_ONLY\x10\x02\x12\x1d\n" + "\x17EDITION_99997_TEST_ONLY\x10\x9d\x8d\x06\x12\x1d\n" + diff --git a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go index 06d584c14..484c21fd5 100644 --- a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go @@ -172,13 +172,14 @@ import ( // ) to obtain a formatter capable of generating timestamps in this format. type Timestamp struct { state protoimpl.MessageState `protogen:"open.v1"` - // Represents seconds of UTC time since Unix epoch - // 1970-01-01T00:00:00Z. Must be from 0001-01-01T00:00:00Z to - // 9999-12-31T23:59:59Z inclusive. + // Represents seconds of UTC time since Unix epoch 1970-01-01T00:00:00Z. Must + // be between -315576000000 and 315576000000 inclusive (which corresponds to + // 0001-01-01T00:00:00Z to 9999-12-31T23:59:59Z). Seconds int64 `protobuf:"varint,1,opt,name=seconds,proto3" json:"seconds,omitempty"` - // Non-negative fractions of a second at nanosecond resolution. Negative - // second values with fractions must still have non-negative nanos values - // that count forward in time. Must be from 0 to 999,999,999 + // Non-negative fractions of a second at nanosecond resolution. This field is + // the nanosecond portion of the duration, not an alternative to seconds. + // Negative second values with fractions must still have non-negative nanos + // values that count forward in time. Must be between 0 and 999,999,999 // inclusive. Nanos int32 `protobuf:"varint,2,opt,name=nanos,proto3" json:"nanos,omitempty"` unknownFields protoimpl.UnknownFields diff --git a/vendor/kmodules.xyz/client-go/Makefile b/vendor/kmodules.xyz/client-go/Makefile index 0d1f72430..e1ae45202 100644 --- a/vendor/kmodules.xyz/client-go/Makefile +++ b/vendor/kmodules.xyz/client-go/Makefile @@ -19,11 +19,11 @@ REPO := $(notdir $(shell pwd)) BIN := client-go # https://github.com/appscodelabs/gengo-builder -CODE_GENERATOR_IMAGE ?= ghcr.io/appscode/gengo:release-1.32 +CODE_GENERATOR_IMAGE ?= ghcr.io/appscode/gengo:release-1.34 # This version-strategy uses git tags to set the version string git_branch := $(shell git rev-parse --abbrev-ref HEAD) -git_tag := $(shell git describe --exact-match --abbrev=0 2>/dev/null || echo "") +git_tag := $(shell git describe --tags --exact-match --abbrev=0 2>/dev/null || echo "") commit_hash := $(shell git rev-parse --verify HEAD) commit_timestamp := $(shell date --date="@$$(git show -s --format=%ct)" --utc +%FT%T) @@ -114,8 +114,8 @@ clientset: $(CODE_GENERATOR_IMAGE) \ deepcopy-gen \ --go-header-file "./hack/license/go.txt" \ - --input-dirs "$(GO_PKG)/$(REPO)/api/v1" \ - --output-file-base zz_generated.deepcopy + --output-file zz_generated.deepcopy.go \ + $(GO_PKG)/$(REPO)/api/v1 # Generate openapi schema .PHONY: openapi @@ -132,9 +132,11 @@ openapi: openapi-gen \ --v 1 --logtostderr \ --go-header-file "./hack/license/go.txt" \ - --input-dirs "$(GO_PKG)/$(REPO)/api/v1" \ - --output-package "$(GO_PKG)/$(REPO)/api/v1" \ - --report-filename /tmp/violation_exceptions.list + --output-dir "$(DOCKER_REPO_ROOT)/api/v1" \ + --output-pkg "$(GO_PKG)/$(REPO)/api/v1" \ + --output-file "openapi_generated.go" \ + --report-filename /tmp/violation_exceptions.list \ + $(GO_PKG)/$(REPO)/api/v1 .PHONY: gen-crd-protos gen-crd-protos: diff --git a/vendor/kmodules.xyz/client-go/api/v1/cluster.go b/vendor/kmodules.xyz/client-go/api/v1/cluster.go index 68fe02110..c10d69e65 100644 --- a/vendor/kmodules.xyz/client-go/api/v1/cluster.go +++ b/vendor/kmodules.xyz/client-go/api/v1/cluster.go @@ -85,6 +85,26 @@ type ClusterMetadata struct { HubClusterID string `json:"hubClusterID,omitempty" protobuf:"bytes,10,opt,name=hubClusterID"` CloudServiceAuthMode string `json:"cloudServiceAuthMode,omitempty" protobuf:"bytes,11,opt,name=cloudServiceAuthMode"` Mode ClusterMode `json:"mode,omitempty" protobuf:"bytes,12,opt,name=mode,casttype=ClusterMode"` + License *LicenseInfo `json:"license,omitempty" protobuf:"bytes,13,opt,name=license"` +} + +// +kubebuilder:validation:Enum=appscode;selfhosted +type LicenseDistributor string + +const ( + LicenseDistributorAppsCode LicenseDistributor = "appscode" + LicenseDistributorSelfHosted LicenseDistributor = "selfhosted" +) + +type LicenseInfo struct { + Distributor LicenseDistributor `json:"distributor,omitempty" protobuf:"bytes,1,opt,name=distributor,casttype=LicenseDistributor"` + // Endpoint is the platform-api to acquire licenses from, when Distributor is selfhosted. + Endpoint string `json:"endpoint,omitempty" protobuf:"bytes,2,opt,name=endpoint"` + OrgID string `json:"orgID,omitempty" protobuf:"bytes,3,opt,name=orgID"` +} + +func (l *LicenseInfo) IsEmpty() bool { + return l == nil || (l.Distributor == "" && l.Endpoint == "" && l.OrgID == "") } func (md ClusterMetadata) Manager() string { diff --git a/vendor/kmodules.xyz/client-go/api/v1/generated.pb.go b/vendor/kmodules.xyz/client-go/api/v1/generated.pb.go index b70728acd..960901b3a 100644 --- a/vendor/kmodules.xyz/client-go/api/v1/generated.pb.go +++ b/vendor/kmodules.xyz/client-go/api/v1/generated.pb.go @@ -325,10 +325,38 @@ func (m *ImageInfo) XXX_DiscardUnknown() { var xxx_messageInfo_ImageInfo proto.InternalMessageInfo +func (m *LicenseInfo) Reset() { *m = LicenseInfo{} } +func (*LicenseInfo) ProtoMessage() {} +func (*LicenseInfo) Descriptor() ([]byte, []int) { + return fileDescriptor_af8e7a11c7a1ccd9, []int{10} +} +func (m *LicenseInfo) XXX_Unmarshal(b []byte) error { + return m.Unmarshal(b) +} +func (m *LicenseInfo) XXX_Marshal(b []byte, deterministic bool) ([]byte, error) { + b = b[:cap(b)] + n, err := m.MarshalToSizedBuffer(b) + if err != nil { + return nil, err + } + return b[:n], nil +} +func (m *LicenseInfo) XXX_Merge(src proto.Message) { + xxx_messageInfo_LicenseInfo.Merge(m, src) +} +func (m *LicenseInfo) XXX_Size() int { + return m.Size() +} +func (m *LicenseInfo) XXX_DiscardUnknown() { + xxx_messageInfo_LicenseInfo.DiscardUnknown(m) +} + +var xxx_messageInfo_LicenseInfo proto.InternalMessageInfo + func (m *Lineage) Reset() { *m = Lineage{} } func (*Lineage) ProtoMessage() {} func (*Lineage) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{10} + return fileDescriptor_af8e7a11c7a1ccd9, []int{11} } func (m *Lineage) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -356,7 +384,7 @@ var xxx_messageInfo_Lineage proto.InternalMessageInfo func (m *ObjectID) Reset() { *m = ObjectID{} } func (*ObjectID) ProtoMessage() {} func (*ObjectID) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{11} + return fileDescriptor_af8e7a11c7a1ccd9, []int{12} } func (m *ObjectID) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -384,7 +412,7 @@ var xxx_messageInfo_ObjectID proto.InternalMessageInfo func (m *ObjectInfo) Reset() { *m = ObjectInfo{} } func (*ObjectInfo) ProtoMessage() {} func (*ObjectInfo) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{12} + return fileDescriptor_af8e7a11c7a1ccd9, []int{13} } func (m *ObjectInfo) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -412,7 +440,7 @@ var xxx_messageInfo_ObjectInfo proto.InternalMessageInfo func (m *ObjectReference) Reset() { *m = ObjectReference{} } func (*ObjectReference) ProtoMessage() {} func (*ObjectReference) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{13} + return fileDescriptor_af8e7a11c7a1ccd9, []int{14} } func (m *ObjectReference) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -440,7 +468,7 @@ var xxx_messageInfo_ObjectReference proto.InternalMessageInfo func (m *PullCredentials) Reset() { *m = PullCredentials{} } func (*PullCredentials) ProtoMessage() {} func (*PullCredentials) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{14} + return fileDescriptor_af8e7a11c7a1ccd9, []int{15} } func (m *PullCredentials) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -468,7 +496,7 @@ var xxx_messageInfo_PullCredentials proto.InternalMessageInfo func (m *ReadonlyHealthCheckSpec) Reset() { *m = ReadonlyHealthCheckSpec{} } func (*ReadonlyHealthCheckSpec) ProtoMessage() {} func (*ReadonlyHealthCheckSpec) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{15} + return fileDescriptor_af8e7a11c7a1ccd9, []int{16} } func (m *ReadonlyHealthCheckSpec) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -496,7 +524,7 @@ var xxx_messageInfo_ReadonlyHealthCheckSpec proto.InternalMessageInfo func (m *ResourceID) Reset() { *m = ResourceID{} } func (*ResourceID) ProtoMessage() {} func (*ResourceID) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{16} + return fileDescriptor_af8e7a11c7a1ccd9, []int{17} } func (m *ResourceID) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -524,7 +552,7 @@ var xxx_messageInfo_ResourceID proto.InternalMessageInfo func (m *TLSConfig) Reset() { *m = TLSConfig{} } func (*TLSConfig) ProtoMessage() {} func (*TLSConfig) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{17} + return fileDescriptor_af8e7a11c7a1ccd9, []int{18} } func (m *TLSConfig) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -552,7 +580,7 @@ var xxx_messageInfo_TLSConfig proto.InternalMessageInfo func (m *TimeOfDay) Reset() { *m = TimeOfDay{} } func (*TimeOfDay) ProtoMessage() {} func (*TimeOfDay) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{18} + return fileDescriptor_af8e7a11c7a1ccd9, []int{19} } func (m *TimeOfDay) XXX_Unmarshal(b []byte) error { return xxx_messageInfo_TimeOfDay.Unmarshal(m, b) @@ -575,7 +603,7 @@ var xxx_messageInfo_TimeOfDay proto.InternalMessageInfo func (m *TypeReference) Reset() { *m = TypeReference{} } func (*TypeReference) ProtoMessage() {} func (*TypeReference) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{19} + return fileDescriptor_af8e7a11c7a1ccd9, []int{20} } func (m *TypeReference) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -603,7 +631,7 @@ var xxx_messageInfo_TypeReference proto.InternalMessageInfo func (m *TypedObjectReference) Reset() { *m = TypedObjectReference{} } func (*TypedObjectReference) ProtoMessage() {} func (*TypedObjectReference) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{20} + return fileDescriptor_af8e7a11c7a1ccd9, []int{21} } func (m *TypedObjectReference) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -631,7 +659,7 @@ var xxx_messageInfo_TypedObjectReference proto.InternalMessageInfo func (m *X509Subject) Reset() { *m = X509Subject{} } func (*X509Subject) ProtoMessage() {} func (*X509Subject) Descriptor() ([]byte, []int) { - return fileDescriptor_af8e7a11c7a1ccd9, []int{21} + return fileDescriptor_af8e7a11c7a1ccd9, []int{22} } func (m *X509Subject) XXX_Unmarshal(b []byte) error { return m.Unmarshal(b) @@ -668,6 +696,7 @@ func init() { proto.RegisterType((*Condition)(nil), "kmodules.xyz.client_go.api.v1.Condition") proto.RegisterType((*HealthCheckSpec)(nil), "kmodules.xyz.client_go.api.v1.HealthCheckSpec") proto.RegisterType((*ImageInfo)(nil), "kmodules.xyz.client_go.api.v1.ImageInfo") + proto.RegisterType((*LicenseInfo)(nil), "kmodules.xyz.client_go.api.v1.LicenseInfo") proto.RegisterType((*Lineage)(nil), "kmodules.xyz.client_go.api.v1.Lineage") proto.RegisterType((*ObjectID)(nil), "kmodules.xyz.client_go.api.v1.ObjectID") proto.RegisterType((*ObjectInfo)(nil), "kmodules.xyz.client_go.api.v1.ObjectInfo") @@ -687,141 +716,146 @@ func init() { } var fileDescriptor_af8e7a11c7a1ccd9 = []byte{ - // 2140 bytes of a gzipped FileDescriptorProto - 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0xb4, 0x58, 0xcf, 0x6f, 0x1c, 0x49, - 0xf5, 0x77, 0x67, 0xc6, 0xf1, 0xcc, 0x1b, 0x3b, 0x4e, 0x2a, 0xfe, 0x2a, 0x93, 0x7c, 0x37, 0x1e, - 0xd3, 0x11, 0x51, 0x02, 0x9b, 0x36, 0x8e, 0x12, 0x08, 0x11, 0x08, 0x3c, 0x63, 0x27, 0x99, 0x5d, - 0x3b, 0x1e, 0x6a, 0x1c, 0x76, 0xb5, 0x8b, 0x58, 0x95, 0xbb, 0xcb, 0xe3, 0xc2, 0x3d, 0xdd, 0xad, - 0xaa, 0xee, 0xd9, 0x9d, 0x3d, 0x2d, 0x27, 0x40, 0x5c, 0x96, 0x1b, 0xc7, 0x8d, 0xc4, 0x9f, 0x80, - 0x84, 0xf8, 0x0b, 0xc8, 0x31, 0x5c, 0xd0, 0x4a, 0xa0, 0x11, 0x19, 0xae, 0x88, 0x0b, 0x42, 0x02, - 0x9f, 0x50, 0x55, 0x57, 0xff, 0x98, 0xf6, 0x78, 0xed, 0x85, 0xe5, 0x36, 0xf3, 0xde, 0xe7, 0x7d, - 0xea, 0x55, 0xd5, 0xab, 0xf7, 0xa3, 0xe1, 0xce, 0x61, 0xdf, 0x77, 0x22, 0x97, 0x0a, 0xeb, 0x83, - 0xe1, 0x87, 0xab, 0xb6, 0xcb, 0xa8, 0x17, 0xde, 0xe9, 0xf9, 0xab, 0x24, 0x60, 0xab, 0x83, 0xb5, - 0xd5, 0x1e, 0xf5, 0x28, 0x27, 0x21, 0x75, 0xac, 0x80, 0xfb, 0xa1, 0x8f, 0xae, 0xe7, 0xe1, 0x56, - 0x0c, 0x7f, 0xaf, 0xe7, 0x5b, 0x24, 0x60, 0xd6, 0x60, 0xed, 0xda, 0x9d, 0x1e, 0x0b, 0x0f, 0xa2, - 0x3d, 0xcb, 0xf6, 0xfb, 0xab, 0x3d, 0xbf, 0xe7, 0xaf, 0x2a, 0xab, 0xbd, 0x68, 0x5f, 0xfd, 0x53, - 0x7f, 0xd4, 0xaf, 0x98, 0xed, 0x9a, 0x79, 0xf8, 0x40, 0x58, 0x2c, 0x5e, 0xcc, 0xf6, 0x39, 0x9d, - 0xb2, 0xe2, 0xb5, 0x7b, 0x19, 0xa6, 0x4f, 0xec, 0x03, 0xe6, 0x51, 0x3e, 0x5c, 0x0d, 0x0e, 0x7b, - 0x52, 0x20, 0x56, 0xfb, 0x34, 0x24, 0x53, 0xac, 0xcc, 0xdf, 0x18, 0xb0, 0xd8, 0x5a, 0xef, 0xb4, - 0x5b, 0x6e, 0x24, 0x42, 0xca, 0xdb, 0xde, 0xbe, 0x8f, 0xbe, 0x05, 0x95, 0x80, 0xfb, 0x03, 0xe6, - 0x50, 0x5e, 0x37, 0x56, 0x8c, 0x5b, 0xd5, 0xe6, 0xca, 0x8b, 0x51, 0x63, 0x66, 0x3c, 0x6a, 0x54, - 0x3a, 0x5a, 0x7e, 0x34, 0x6a, 0xcc, 0x4b, 0xb3, 0xe4, 0x3f, 0x4e, 0x2d, 0xd0, 0x2a, 0x54, 0x3d, - 0xd2, 0xa7, 0x22, 0x20, 0x36, 0xad, 0x9f, 0x53, 0xe6, 0x97, 0xb4, 0x79, 0xf5, 0x69, 0xa2, 0xc0, - 0x19, 0x06, 0xdd, 0x87, 0x9a, 0x1d, 0xaf, 0x2e, 0xd5, 0xf5, 0x92, 0x32, 0xb9, 0xac, 0x4d, 0x6a, - 0xad, 0x4c, 0x85, 0xf3, 0x38, 0xf3, 0x5d, 0xf8, 0xbf, 0x16, 0xe5, 0x21, 0xdb, 0x67, 0x36, 0x09, - 0x69, 0x87, 0xb3, 0x01, 0x09, 0xe9, 0x9b, 0x74, 0x88, 0x9a, 0x50, 0xa1, 0x9e, 0xed, 0x3b, 0xcc, - 0xeb, 0x69, 0xf7, 0x6f, 0x26, 0xee, 0x6f, 0x6a, 0xf9, 0xd1, 0xa8, 0x81, 0x32, 0x8b, 0x44, 0x8a, - 0x53, 0x3b, 0xf3, 0xef, 0xb3, 0xb0, 0x98, 0x63, 0xef, 0x06, 0xd4, 0x46, 0x37, 0x60, 0x96, 0xb8, - 0x8c, 0x08, 0x4d, 0xba, 0xa0, 0x49, 0x67, 0xd7, 0xa5, 0x10, 0xc7, 0x3a, 0xf4, 0x0e, 0x54, 0x99, - 0x10, 0x11, 0xe5, 0x98, 0xee, 0xab, 0xdd, 0xd7, 0xee, 0xde, 0xb1, 0xe2, 0x9b, 0x51, 0x77, 0x2f, - 0x6f, 0xcf, 0x1a, 0xac, 0x59, 0xbb, 0xc3, 0x80, 0x3a, 0x5b, 0xbe, 0x4d, 0xdc, 0x9d, 0xbd, 0x1f, - 0x51, 0x3b, 0xc4, 0x74, 0x9f, 0x72, 0xea, 0xd9, 0xb4, 0xb9, 0x20, 0x0f, 0xaa, 0x9d, 0x70, 0xe0, - 0x8c, 0x0e, 0xdd, 0x05, 0x10, 0xd4, 0xe6, 0x34, 0xcc, 0x9d, 0x13, 0xd2, 0x5e, 0x40, 0x37, 0xd5, - 0xe0, 0x1c, 0x0a, 0x7d, 0x0f, 0xe6, 0x44, 0xa4, 0x56, 0xa8, 0x97, 0x95, 0x37, 0x5f, 0xb1, 0x3e, - 0x33, 0x32, 0xad, 0xb7, 0xef, 0x7f, 0xed, 0x9b, 0xdd, 0xd8, 0xa2, 0x59, 0x1b, 0x8f, 0x1a, 0x73, - 0xfa, 0x0f, 0x4e, 0x78, 0xd0, 0xdb, 0x50, 0x71, 0x22, 0x4e, 0x42, 0xe6, 0x7b, 0xf5, 0x59, 0xc5, - 0x69, 0xe5, 0x76, 0x98, 0xc6, 0x9e, 0x15, 0x1c, 0xf6, 0xa4, 0x40, 0x58, 0x32, 0xf6, 0x24, 0xf5, - 0x86, 0xb6, 0x6a, 0xce, 0xcb, 0xbb, 0x48, 0xfe, 0xe1, 0x94, 0x0d, 0x11, 0xa8, 0x71, 0xea, 0xd1, - 0xf7, 0x9b, 0x74, 0xdf, 0xe7, 0xb4, 0x7e, 0xfe, 0x3f, 0x22, 0x5f, 0x94, 0x51, 0x83, 0x33, 0x1a, - 0x9c, 0xe7, 0x44, 0xb7, 0xa0, 0xe2, 0x78, 0x42, 0xc5, 0x61, 0x7d, 0x6e, 0xa5, 0x74, 0xab, 0xaa, - 0x9d, 0x79, 0xda, 0x55, 0x32, 0x9c, 0x6a, 0xd1, 0x1a, 0xd4, 0x58, 0xb0, 0xee, 0x38, 0x9c, 0x0a, - 0x41, 0x45, 0xbd, 0xa2, 0xc0, 0x8a, 0xbc, 0xdd, 0x49, 0xc5, 0x38, 0x8f, 0x41, 0xaf, 0x41, 0x39, - 0xe2, 0x4c, 0xd4, 0xab, 0x0a, 0x5b, 0x19, 0x8f, 0x1a, 0xe5, 0x67, 0xb8, 0x2d, 0xb0, 0x92, 0xa2, - 0x87, 0x70, 0x81, 0xf6, 0x09, 0x73, 0x33, 0x4e, 0x50, 0x38, 0x34, 0x1e, 0x35, 0x2e, 0x6c, 0x4e, - 0x68, 0x70, 0x01, 0x89, 0x1c, 0x80, 0x20, 0x8d, 0xd7, 0x7a, 0x4d, 0x1d, 0xcc, 0xbd, 0x53, 0x6e, - 0x72, 0xea, 0xeb, 0x68, 0x5e, 0x90, 0xc1, 0x92, 0xfd, 0xc7, 0x39, 0x5e, 0xf3, 0x27, 0x25, 0x58, - 0xd2, 0xef, 0xad, 0xe5, 0x12, 0xd6, 0x7f, 0x44, 0x49, 0x18, 0x71, 0x2a, 0xd0, 0xcf, 0x0d, 0x58, - 0xa4, 0x1e, 0xd9, 0x73, 0xa9, 0x93, 0xc8, 0xea, 0xc6, 0x4a, 0xe9, 0x56, 0xed, 0xee, 0x93, 0xd3, - 0x9c, 0x98, 0x42, 0x67, 0x6d, 0x4e, 0x52, 0x6d, 0x7a, 0x21, 0x1f, 0x36, 0xaf, 0xe8, 0x48, 0x5e, - 0x2c, 0x68, 0x71, 0x71, 0x65, 0xf4, 0x2e, 0x5c, 0xa5, 0x1f, 0x84, 0x94, 0x7b, 0xc4, 0x75, 0x87, - 0xdb, 0xc4, 0x23, 0xbd, 0x9c, 0x5b, 0xe7, 0xd4, 0x99, 0x5e, 0x1f, 0x8f, 0x1a, 0x57, 0x37, 0x4f, - 0x02, 0xe1, 0x93, 0xed, 0xd1, 0x77, 0xe1, 0xa2, 0xc3, 0xc4, 0xe4, 0x56, 0x4b, 0x8a, 0x73, 0x69, - 0x3c, 0x6a, 0x5c, 0xdc, 0x28, 0xe8, 0xf0, 0x31, 0xf4, 0xb5, 0x26, 0x2c, 0x4d, 0xdb, 0x20, 0xba, - 0x08, 0xa5, 0x43, 0x3a, 0x8c, 0xb3, 0x07, 0x96, 0x3f, 0xd1, 0x12, 0xcc, 0x0e, 0x88, 0x1b, 0xe9, - 0x34, 0x89, 0xe3, 0x3f, 0x0f, 0xcf, 0x3d, 0x30, 0xcc, 0x1f, 0x1b, 0x70, 0x31, 0x7f, 0x74, 0x2a, - 0x2f, 0xf7, 0x61, 0x51, 0x27, 0xc0, 0x6d, 0x1a, 0x12, 0x87, 0x84, 0x44, 0x91, 0x9d, 0xfe, 0xa6, - 0x73, 0xc9, 0x3d, 0x3b, 0xe6, 0xd6, 0x24, 0x15, 0x2e, 0x72, 0x9b, 0x7f, 0x34, 0xa0, 0x96, 0x2f, - 0x0b, 0xd7, 0xa1, 0x14, 0x31, 0x47, 0x67, 0xbf, 0x9a, 0xa6, 0x29, 0x3d, 0x6b, 0x6f, 0x60, 0x29, - 0x47, 0x2b, 0x50, 0x96, 0x39, 0x5d, 0xa7, 0xfc, 0x79, 0xad, 0x2f, 0xab, 0x8c, 0xa4, 0x34, 0xe8, - 0xdb, 0x99, 0xff, 0xea, 0xd0, 0x79, 0x72, 0xb2, 0x97, 0xf3, 0xfe, 0x68, 0x15, 0x2e, 0x62, 0xd1, - 0x16, 0x94, 0x6d, 0x12, 0x30, 0x9d, 0xc7, 0xac, 0xd3, 0xf6, 0x3c, 0x59, 0xd4, 0xe2, 0xd7, 0x28, - 0x85, 0x58, 0xb1, 0x98, 0xff, 0x2a, 0x43, 0xf1, 0x08, 0xfe, 0xfb, 0x1d, 0xde, 0x87, 0x9a, 0xc3, - 0x44, 0xe0, 0x92, 0xe1, 0xb4, 0x52, 0xb6, 0x91, 0xa9, 0x70, 0x1e, 0x87, 0xbe, 0x93, 0x2b, 0xb8, - 0x65, 0x65, 0x73, 0x63, 0x4a, 0xc1, 0x5d, 0x7c, 0xe2, 0x8b, 0x90, 0x79, 0xbd, 0x29, 0x35, 0xf7, - 0x36, 0xcc, 0xf9, 0xef, 0x7b, 0x94, 0xb7, 0x37, 0x54, 0x46, 0xae, 0x36, 0x17, 0xb5, 0xfd, 0xdc, - 0x4e, 0x2c, 0xc6, 0x89, 0x5e, 0x96, 0x67, 0xf5, 0x53, 0x16, 0x20, 0x95, 0x61, 0x73, 0xe5, 0x79, - 0x27, 0x51, 0xe0, 0x0c, 0x23, 0xf7, 0x44, 0x02, 0xb6, 0xe9, 0x39, 0x81, 0xcf, 0xbc, 0xb0, 0x3e, - 0x37, 0xb9, 0xa7, 0xf5, 0x4e, 0x3b, 0x51, 0xe1, 0x3c, 0x0e, 0xbd, 0x0e, 0x15, 0x9b, 0x34, 0x23, - 0xcf, 0x71, 0x69, 0xbd, 0xa2, 0x6c, 0x2e, 0x26, 0x7b, 0x6a, 0xad, 0xc7, 0x72, 0x9c, 0x22, 0xa4, - 0x57, 0xfd, 0xf8, 0x9e, 0xdb, 0x1b, 0xf5, 0xea, 0xa4, 0x57, 0xdb, 0x89, 0x02, 0x67, 0x18, 0xf4, - 0x00, 0xe6, 0x0f, 0xa2, 0xbd, 0xe4, 0x82, 0x37, 0xea, 0xa0, 0x6c, 0x96, 0xb4, 0xcd, 0xfc, 0x93, - 0x9c, 0x0e, 0x4f, 0x20, 0x51, 0x07, 0x96, 0x6c, 0xd7, 0x8f, 0x9c, 0x2e, 0xe5, 0x03, 0x66, 0xd3, - 0xf5, 0x28, 0x3c, 0xd8, 0xf6, 0x1d, 0xaa, 0x92, 0x6a, 0xb5, 0xf9, 0x9a, 0x66, 0x58, 0x6a, 0x4d, - 0xc1, 0xe0, 0xa9, 0x96, 0x68, 0x15, 0xca, 0x7d, 0xc9, 0x30, 0xaf, 0x18, 0xfe, 0x3f, 0x89, 0x0b, - 0xa9, 0x3b, 0xca, 0x3a, 0x18, 0x45, 0xa0, 0x80, 0xe6, 0x3f, 0x4b, 0x50, 0x6d, 0xf9, 0x9e, 0xc3, - 0x54, 0xd5, 0x5b, 0x83, 0x72, 0x28, 0x2f, 0x23, 0xbe, 0xf9, 0xeb, 0x89, 0xb9, 0x3c, 0xfc, 0xa3, - 0x51, 0x63, 0x21, 0x05, 0xaa, 0x8b, 0x51, 0x50, 0xf4, 0x43, 0x38, 0x2f, 0x42, 0x12, 0x46, 0x42, - 0x5f, 0xf7, 0x23, 0x6d, 0x74, 0xbe, 0xab, 0xa4, 0x47, 0xa3, 0xc6, 0x99, 0xba, 0x41, 0x2b, 0xe5, - 0x8e, 0xed, 0xb0, 0x66, 0x45, 0x6f, 0x00, 0xf2, 0xf7, 0x04, 0xe5, 0x03, 0xea, 0x3c, 0x8e, 0x1b, - 0x46, 0x59, 0xec, 0x65, 0x38, 0x97, 0x9a, 0xd7, 0xf4, 0x5a, 0x68, 0xe7, 0x18, 0x02, 0x4f, 0xb1, - 0x42, 0xeb, 0x50, 0x11, 0x74, 0x40, 0x39, 0x0b, 0x87, 0x3a, 0xde, 0xbe, 0x9c, 0x04, 0x42, 0x57, - 0xcb, 0x8f, 0x46, 0x8d, 0x4b, 0x99, 0x2b, 0x5a, 0x88, 0x53, 0x33, 0x34, 0x00, 0xe4, 0x12, 0x11, - 0xee, 0x72, 0xe2, 0x89, 0xf8, 0x28, 0x58, 0x9f, 0xaa, 0x48, 0x54, 0xb9, 0xef, 0x2c, 0xed, 0x81, - 0xb4, 0xc8, 0x5c, 0xdf, 0x3a, 0xc6, 0x86, 0xa7, 0xac, 0x80, 0x6e, 0xc2, 0x79, 0x4e, 0x89, 0xf0, - 0x3d, 0x1d, 0xc1, 0x17, 0x92, 0x63, 0xc6, 0x4a, 0x8a, 0xb5, 0x56, 0x3e, 0xbf, 0x3e, 0x15, 0x82, - 0xf4, 0xa8, 0x8e, 0xdd, 0xf4, 0xf9, 0x6d, 0xc7, 0x62, 0x9c, 0xe8, 0xcd, 0xbf, 0x19, 0xb0, 0xf8, - 0x84, 0x12, 0x37, 0x3c, 0x68, 0x1d, 0x50, 0xfb, 0x50, 0x35, 0x96, 0xbf, 0x30, 0xe0, 0x0a, 0xa7, - 0xc4, 0xf1, 0x3d, 0x77, 0x58, 0xd0, 0xe9, 0x04, 0xff, 0xf5, 0x53, 0x92, 0x1d, 0x9e, 0x6e, 0xdd, - 0x6c, 0x68, 0x3f, 0xae, 0x9c, 0x00, 0xc0, 0x27, 0xad, 0x8b, 0x1e, 0xc3, 0x25, 0x5d, 0xd8, 0xde, - 0xe2, 0x2c, 0xa4, 0x4a, 0xa1, 0x12, 0x5f, 0xa5, 0x79, 0x55, 0x93, 0x5e, 0xda, 0x28, 0x02, 0xf0, - 0x71, 0x1b, 0xf3, 0x1f, 0x06, 0x54, 0xdb, 0x7d, 0xd2, 0xa3, 0xaa, 0x86, 0xdc, 0x80, 0x59, 0x26, - 0xff, 0x14, 0x7b, 0x68, 0x85, 0xc0, 0xb1, 0x0e, 0xed, 0x42, 0xc5, 0x65, 0x1e, 0x25, 0x3d, 0x5d, - 0xce, 0x6b, 0x77, 0x6f, 0x9e, 0xb2, 0xff, 0xad, 0x18, 0x9e, 0xa5, 0x18, 0x2d, 0x10, 0x38, 0x65, - 0x92, 0xd5, 0x33, 0x88, 0x5c, 0xb7, 0xc5, 0xa9, 0x43, 0xbd, 0x90, 0x11, 0x57, 0xa8, 0x80, 0x3e, - 0xbd, 0x92, 0x74, 0x26, 0xad, 0xe2, 0x6a, 0x55, 0x10, 0xe2, 0x22, 0xb7, 0xf9, 0x33, 0x03, 0xe6, - 0xb4, 0x17, 0xe8, 0x29, 0xcc, 0xda, 0x07, 0x84, 0x79, 0xba, 0x67, 0xba, 0x7d, 0xca, 0x82, 0xf1, - 0x44, 0xa0, 0xaa, 0x56, 0x7a, 0x40, 0x2d, 0x69, 0x8f, 0x63, 0x1a, 0x64, 0x01, 0xd8, 0xbe, 0x17, - 0x12, 0x19, 0xeb, 0x49, 0xc7, 0xa3, 0xfa, 0xba, 0x56, 0x2a, 0xc5, 0x39, 0x84, 0xf9, 0x2b, 0x03, - 0x2a, 0x9a, 0x74, 0x43, 0x5e, 0x41, 0x8f, 0xfb, 0x51, 0x50, 0xbc, 0x82, 0xc7, 0x52, 0x88, 0x63, - 0x9d, 0x2c, 0x75, 0x87, 0xcc, 0x73, 0x8a, 0xa5, 0xee, 0x4d, 0xe6, 0x39, 0x58, 0x69, 0x26, 0xc7, - 0xbc, 0xd2, 0x19, 0xc6, 0xbc, 0xa4, 0x7a, 0x96, 0x4f, 0xaa, 0x9e, 0xe6, 0xaf, 0x0d, 0x80, 0x6c, - 0xef, 0xe8, 0x2d, 0xa8, 0x70, 0x2a, 0xfc, 0x88, 0xdb, 0x54, 0x3f, 0x83, 0xdb, 0xa7, 0x3e, 0x83, - 0x18, 0xde, 0xde, 0xc8, 0x22, 0x21, 0x91, 0xe1, 0x94, 0x0c, 0x6d, 0x43, 0x89, 0xa7, 0xd3, 0x99, - 0x75, 0xa6, 0xcb, 0xc8, 0xc6, 0xb3, 0xb4, 0x2d, 0x90, 0xc3, 0x99, 0xe4, 0x31, 0x1d, 0x58, 0x2c, - 0x80, 0x26, 0x0f, 0xc7, 0xf8, 0x1c, 0x87, 0x73, 0x62, 0x6b, 0x61, 0xfe, 0xd5, 0x80, 0x62, 0xd0, - 0x7d, 0xfe, 0x65, 0xde, 0x00, 0x24, 0x74, 0xf1, 0xb2, 0x6d, 0x3f, 0xf2, 0xe2, 0x49, 0x32, 0x5e, - 0x34, 0x4d, 0x8e, 0xdd, 0x63, 0x08, 0x3c, 0xc5, 0x0a, 0xfd, 0x20, 0x99, 0x46, 0x31, 0xdd, 0x8f, - 0x1b, 0xb9, 0xda, 0xdd, 0x5b, 0xd3, 0x46, 0xdd, 0xa9, 0x53, 0x6e, 0x61, 0x6e, 0x95, 0x1c, 0x38, - 0xc7, 0x67, 0xbe, 0x34, 0xe0, 0xa4, 0xa4, 0x85, 0xbe, 0x01, 0x0b, 0x01, 0xe5, 0xcc, 0x77, 0xba, - 0xd4, 0xf6, 0x3d, 0x27, 0x1e, 0xc8, 0x67, 0x9b, 0x97, 0xc6, 0xa3, 0xc6, 0x42, 0x27, 0xaf, 0xc0, - 0x93, 0x38, 0x39, 0x81, 0x85, 0xac, 0x4f, 0xfd, 0x28, 0x4c, 0x2c, 0xcf, 0x29, 0x4b, 0x35, 0x81, - 0xed, 0x4e, 0x68, 0x70, 0x01, 0x29, 0xe7, 0x82, 0x7d, 0xc2, 0xdc, 0x88, 0xd3, 0xdd, 0x03, 0x4e, - 0xc5, 0x81, 0xef, 0x3a, 0x2a, 0xec, 0x67, 0xe3, 0xb9, 0xe0, 0x51, 0x41, 0x87, 0x8f, 0xa1, 0xcd, - 0x3f, 0x18, 0x00, 0x59, 0x84, 0x9e, 0xed, 0x1d, 0xde, 0x86, 0xb9, 0x01, 0xe5, 0x42, 0x56, 0xdf, - 0x73, 0x93, 0x95, 0xe5, 0xfb, 0xb1, 0x18, 0x27, 0xfa, 0x34, 0x84, 0x4a, 0x27, 0x76, 0xa7, 0xc9, - 0xa3, 0x2e, 0x9f, 0xf8, 0xa8, 0xef, 0xc1, 0xac, 0xb0, 0xfd, 0x80, 0xea, 0xb6, 0x62, 0x39, 0xf1, - 0xa9, 0x2b, 0x85, 0xb2, 0x19, 0x49, 0xfc, 0x57, 0x02, 0x1c, 0x83, 0xcd, 0xdf, 0x1b, 0x50, 0xdd, - 0xdd, 0xea, 0xb6, 0x7c, 0x6f, 0x9f, 0xf5, 0x26, 0xbf, 0x80, 0x18, 0x5f, 0xec, 0x17, 0x90, 0x03, - 0x98, 0xb7, 0xb3, 0xa9, 0x36, 0xa9, 0x0e, 0xd6, 0xd9, 0x07, 0x61, 0x55, 0x15, 0xd3, 0x2e, 0x31, - 0xa7, 0x10, 0x78, 0x82, 0xd9, 0xfc, 0x12, 0x54, 0x65, 0x40, 0xec, 0xec, 0x6f, 0x90, 0xe1, 0xc3, - 0xa5, 0x5f, 0x7e, 0xd2, 0x98, 0xf9, 0xe9, 0xf3, 0xc6, 0xcc, 0xc7, 0xcf, 0x1b, 0x33, 0x9f, 0x3c, - 0x6f, 0xcc, 0x7c, 0xf4, 0xa7, 0x95, 0x19, 0xf3, 0x3d, 0x58, 0x50, 0x2d, 0x59, 0xfa, 0xea, 0x5f, - 0x87, 0x0a, 0x09, 0xd8, 0xe3, 0xdc, 0xa5, 0xa6, 0x59, 0x68, 0xbd, 0xd3, 0x8e, 0xef, 0x35, 0x45, - 0x9c, 0x9e, 0x62, 0xcd, 0xdf, 0x1a, 0xb0, 0xa4, 0x4e, 0xa9, 0x98, 0x5e, 0xbe, 0xe0, 0x85, 0xfe, - 0x17, 0xb9, 0xfc, 0x77, 0x25, 0xa8, 0xe5, 0x3e, 0x25, 0xc9, 0x37, 0xeb, 0xf3, 0x1e, 0xf1, 0xd8, - 0x87, 0xaa, 0x2b, 0x8c, 0x3f, 0x1f, 0x54, 0xe3, 0x37, 0xbb, 0x93, 0x57, 0xe0, 0x49, 0x1c, 0xfa, - 0x2a, 0x54, 0x55, 0xce, 0xe1, 0x2c, 0x1d, 0xee, 0x55, 0x7c, 0xb4, 0x12, 0x21, 0xce, 0xf4, 0xa8, - 0x0d, 0x97, 0xf3, 0xd6, 0xc4, 0x7d, 0xe6, 0xb1, 0x30, 0x99, 0x32, 0xaf, 0x8c, 0x47, 0x8d, 0xcb, - 0x3b, 0xc7, 0xd5, 0x78, 0x9a, 0x8d, 0xac, 0xb1, 0xae, 0x0c, 0x4e, 0x16, 0xca, 0x85, 0xcb, 0x59, - 0x8d, 0xdd, 0x4a, 0xa5, 0x38, 0x87, 0x90, 0x7e, 0xaa, 0x71, 0xcc, 0xb3, 0xa9, 0xec, 0xca, 0x53, - 0x3f, 0x3b, 0x89, 0x10, 0x67, 0x7a, 0x39, 0x09, 0x8b, 0x90, 0x53, 0x1a, 0x66, 0xdf, 0x82, 0xce, - 0x67, 0x93, 0x70, 0x77, 0x52, 0x85, 0x8b, 0x58, 0xb4, 0x06, 0xb5, 0xc0, 0x17, 0x21, 0x71, 0x5b, - 0xbe, 0x93, 0x7e, 0xc7, 0x52, 0x9f, 0xa6, 0x3a, 0x99, 0x18, 0xe7, 0x31, 0x72, 0x5e, 0x12, 0x94, - 0x33, 0xe2, 0x3e, 0x8d, 0xfa, 0x7b, 0x94, 0xeb, 0x86, 0x36, 0x7d, 0x09, 0xdd, 0x9c, 0x0e, 0x4f, - 0x20, 0x9b, 0xad, 0x17, 0xaf, 0x96, 0x67, 0x5e, 0xbe, 0x5a, 0x9e, 0xf9, 0xf4, 0xd5, 0xf2, 0xcc, - 0x47, 0xe3, 0x65, 0xe3, 0xc5, 0x78, 0xd9, 0x78, 0x39, 0x5e, 0x36, 0x3e, 0x1d, 0x2f, 0x1b, 0x7f, - 0x1e, 0x2f, 0x1b, 0x1f, 0xff, 0x65, 0x79, 0xe6, 0x9d, 0xeb, 0x9f, 0xf9, 0x79, 0xfc, 0xdf, 0x01, - 0x00, 0x00, 0xff, 0xff, 0x1e, 0x81, 0x20, 0x02, 0x3e, 0x17, 0x00, 0x00, + // 2218 bytes of a gzipped FileDescriptorProto + 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0xb4, 0x59, 0xcd, 0x6f, 0x1c, 0x49, + 0x15, 0x77, 0x7b, 0xc6, 0xf6, 0xcc, 0x1b, 0x3b, 0x4e, 0x2a, 0x46, 0xe9, 0x0d, 0x1b, 0x8f, 0xe9, + 0x15, 0x51, 0x02, 0x9b, 0x31, 0x89, 0x12, 0x08, 0x11, 0x08, 0x3c, 0x33, 0x4e, 0x32, 0x1b, 0x7f, + 0x0c, 0x35, 0x0e, 0xbb, 0xda, 0x45, 0xac, 0xca, 0xdd, 0xe5, 0x71, 0xe1, 0x9e, 0xee, 0x51, 0x55, + 0xf7, 0xec, 0xce, 0x9e, 0x96, 0x13, 0x20, 0x2e, 0xcb, 0x8d, 0xe3, 0x46, 0xe2, 0xca, 0x0d, 0x09, + 0xf1, 0x17, 0x90, 0x03, 0x87, 0x70, 0x41, 0x2b, 0x81, 0x46, 0x64, 0xb8, 0x22, 0x2e, 0x08, 0x09, + 0xf9, 0x84, 0xaa, 0xba, 0xfa, 0x6b, 0x3c, 0x5e, 0x7b, 0x61, 0xb9, 0x4d, 0xbf, 0xf7, 0x7b, 0xbf, + 0xfa, 0x7a, 0x5f, 0x55, 0x03, 0xb7, 0x8e, 0x7a, 0xbe, 0x13, 0xba, 0x54, 0xd4, 0xde, 0x1f, 0x7e, + 0xb0, 0x6e, 0xbb, 0x8c, 0x7a, 0xc1, 0xad, 0xae, 0xbf, 0x4e, 0xfa, 0x6c, 0x7d, 0x70, 0x7b, 0xbd, + 0x4b, 0x3d, 0xca, 0x49, 0x40, 0x9d, 0x5a, 0x9f, 0xfb, 0x81, 0x8f, 0xae, 0x65, 0xe1, 0xb5, 0x08, + 0xfe, 0x6e, 0xd7, 0xaf, 0x91, 0x3e, 0xab, 0x0d, 0x6e, 0x5f, 0xbd, 0xd5, 0x65, 0xc1, 0x61, 0xb8, + 0x5f, 0xb3, 0xfd, 0xde, 0x7a, 0xd7, 0xef, 0xfa, 0xeb, 0xca, 0x6a, 0x3f, 0x3c, 0x50, 0x5f, 0xea, + 0x43, 0xfd, 0x8a, 0xd8, 0xae, 0x5a, 0x47, 0xf7, 0x45, 0x8d, 0x45, 0x83, 0xd9, 0x3e, 0xa7, 0x53, + 0x46, 0xbc, 0x7a, 0x37, 0xc5, 0xf4, 0x88, 0x7d, 0xc8, 0x3c, 0xca, 0x87, 0xeb, 0xfd, 0xa3, 0xae, + 0x14, 0x88, 0xf5, 0x1e, 0x0d, 0xc8, 0x14, 0x2b, 0xeb, 0xb7, 0x06, 0x2c, 0x37, 0x36, 0xda, 0xad, + 0x86, 0x1b, 0x8a, 0x80, 0xf2, 0x96, 0x77, 0xe0, 0xa3, 0x6f, 0x41, 0xa9, 0xcf, 0xfd, 0x01, 0x73, + 0x28, 0x37, 0x8d, 0x35, 0xe3, 0x46, 0xb9, 0xbe, 0xf6, 0x7c, 0x54, 0x9d, 0x19, 0x8f, 0xaa, 0xa5, + 0xb6, 0x96, 0x1f, 0x8f, 0xaa, 0x8b, 0xd2, 0x2c, 0xfe, 0xc6, 0x89, 0x05, 0x5a, 0x87, 0xb2, 0x47, + 0x7a, 0x54, 0xf4, 0x89, 0x4d, 0xcd, 0x59, 0x65, 0x7e, 0x49, 0x9b, 0x97, 0x77, 0x62, 0x05, 0x4e, + 0x31, 0xe8, 0x1e, 0x54, 0xec, 0x68, 0x74, 0xa9, 0x36, 0x0b, 0xca, 0xe4, 0xb2, 0x36, 0xa9, 0x34, + 0x52, 0x15, 0xce, 0xe2, 0xac, 0x77, 0xe0, 0x0b, 0x0d, 0xca, 0x03, 0x76, 0xc0, 0x6c, 0x12, 0xd0, + 0x36, 0x67, 0x03, 0x12, 0xd0, 0x27, 0x74, 0x88, 0xea, 0x50, 0xa2, 0x9e, 0xed, 0x3b, 0xcc, 0xeb, + 0xea, 0xe9, 0x5f, 0x8f, 0xa7, 0xbf, 0xa9, 0xe5, 0xc7, 0xa3, 0x2a, 0x4a, 0x2d, 0x62, 0x29, 0x4e, + 0xec, 0xac, 0x7f, 0xce, 0xc1, 0x72, 0x86, 0xbd, 0xd3, 0xa7, 0x36, 0x7a, 0x0d, 0xe6, 0x88, 0xcb, + 0x88, 0xd0, 0xa4, 0x4b, 0x9a, 0x74, 0x6e, 0x43, 0x0a, 0x71, 0xa4, 0x43, 0x6f, 0x43, 0x99, 0x09, + 0x11, 0x52, 0x8e, 0xe9, 0x81, 0x5a, 0x7d, 0xe5, 0xce, 0xad, 0x5a, 0x74, 0x32, 0xea, 0xec, 0xe5, + 0xe9, 0xd5, 0x06, 0xb7, 0x6b, 0x7b, 0xc3, 0x3e, 0x75, 0xb6, 0x7c, 0x9b, 0xb8, 0xbb, 0xfb, 0x3f, + 0xa2, 0x76, 0x80, 0xe9, 0x01, 0xe5, 0xd4, 0xb3, 0x69, 0x7d, 0x49, 0x6e, 0x54, 0x2b, 0xe6, 0xc0, + 0x29, 0x1d, 0xba, 0x03, 0x20, 0xa8, 0xcd, 0x69, 0x90, 0xd9, 0x27, 0xa4, 0x67, 0x01, 0x9d, 0x44, + 0x83, 0x33, 0x28, 0xf4, 0x3d, 0x58, 0x10, 0xa1, 0x1a, 0xc1, 0x2c, 0xaa, 0xd9, 0x7c, 0xa5, 0xf6, + 0xa9, 0x9e, 0x59, 0x7b, 0xeb, 0xde, 0xd7, 0xbe, 0xd9, 0x89, 0x2c, 0xea, 0x95, 0xf1, 0xa8, 0xba, + 0xa0, 0x3f, 0x70, 0xcc, 0x83, 0xde, 0x82, 0x92, 0x13, 0x72, 0x12, 0x30, 0xdf, 0x33, 0xe7, 0x14, + 0x67, 0x2d, 0xb3, 0xc2, 0xc4, 0xf7, 0x6a, 0xfd, 0xa3, 0xae, 0x14, 0x88, 0x9a, 0xf4, 0x3d, 0x49, + 0xdd, 0xd4, 0x56, 0xf5, 0x45, 0x79, 0x16, 0xf1, 0x17, 0x4e, 0xd8, 0x10, 0x81, 0x0a, 0xa7, 0x1e, + 0x7d, 0xaf, 0x4e, 0x0f, 0x7c, 0x4e, 0xcd, 0xf9, 0xff, 0x8a, 0x7c, 0x59, 0x7a, 0x0d, 0x4e, 0x69, + 0x70, 0x96, 0x13, 0xdd, 0x80, 0x92, 0xe3, 0x09, 0xe5, 0x87, 0xe6, 0xc2, 0x5a, 0xe1, 0x46, 0x59, + 0x4f, 0x66, 0xa7, 0xa3, 0x64, 0x38, 0xd1, 0xa2, 0xdb, 0x50, 0x61, 0xfd, 0x0d, 0xc7, 0xe1, 0x54, + 0x08, 0x2a, 0xcc, 0x92, 0x02, 0x2b, 0xf2, 0x56, 0x3b, 0x11, 0xe3, 0x2c, 0x06, 0xbd, 0x0a, 0xc5, + 0x90, 0x33, 0x61, 0x96, 0x15, 0xb6, 0x34, 0x1e, 0x55, 0x8b, 0x4f, 0x71, 0x4b, 0x60, 0x25, 0x45, + 0x0f, 0xe0, 0x02, 0xed, 0x11, 0xe6, 0xa6, 0x9c, 0xa0, 0x70, 0x68, 0x3c, 0xaa, 0x5e, 0xd8, 0xcc, + 0x69, 0xf0, 0x04, 0x12, 0x39, 0x00, 0xfd, 0xc4, 0x5f, 0xcd, 0x8a, 0xda, 0x98, 0xbb, 0x67, 0x9c, + 0xe4, 0xd4, 0xe8, 0xa8, 0x5f, 0x90, 0xce, 0x92, 0x7e, 0xe3, 0x0c, 0xaf, 0xf5, 0x93, 0x02, 0xac, + 0xe8, 0x78, 0x6b, 0xb8, 0x84, 0xf5, 0x1e, 0x52, 0x12, 0x84, 0x9c, 0x0a, 0xf4, 0x73, 0x03, 0x96, + 0xa9, 0x47, 0xf6, 0x5d, 0xea, 0xc4, 0x32, 0xd3, 0x58, 0x2b, 0xdc, 0xa8, 0xdc, 0x79, 0x7c, 0xd6, + 0x24, 0xa6, 0xd0, 0xd5, 0x36, 0xf3, 0x54, 0x9b, 0x5e, 0xc0, 0x87, 0xf5, 0x2b, 0xda, 0x93, 0x97, + 0x27, 0xb4, 0x78, 0x72, 0x64, 0xf4, 0x0e, 0xbc, 0x42, 0xdf, 0x0f, 0x28, 0xf7, 0x88, 0xeb, 0x0e, + 0xb7, 0x89, 0x47, 0xba, 0x99, 0x69, 0xcd, 0xaa, 0x3d, 0xbd, 0x36, 0x1e, 0x55, 0x5f, 0xd9, 0x3c, + 0x0d, 0x84, 0x4f, 0xb7, 0x47, 0xdf, 0x85, 0x8b, 0x0e, 0x13, 0xf9, 0xa5, 0x16, 0x14, 0xe7, 0xca, + 0x78, 0x54, 0xbd, 0xd8, 0x9c, 0xd0, 0xe1, 0x13, 0xe8, 0xab, 0x75, 0x58, 0x99, 0xb6, 0x40, 0x74, + 0x11, 0x0a, 0x47, 0x74, 0x18, 0x65, 0x0f, 0x2c, 0x7f, 0xa2, 0x15, 0x98, 0x1b, 0x10, 0x37, 0xd4, + 0x69, 0x12, 0x47, 0x1f, 0x0f, 0x66, 0xef, 0x1b, 0xd6, 0x8f, 0x0d, 0xb8, 0x98, 0xdd, 0x3a, 0x95, + 0x97, 0x7b, 0xb0, 0xac, 0x13, 0xe0, 0x36, 0x0d, 0x88, 0x43, 0x02, 0x62, 0x1a, 0xe7, 0x8a, 0xe9, + 0x4c, 0x72, 0x4f, 0xb7, 0xb9, 0x91, 0xa7, 0xc2, 0x93, 0xdc, 0xd6, 0x9f, 0x0d, 0xa8, 0x64, 0xcb, + 0xc2, 0x35, 0x28, 0x84, 0xcc, 0xd1, 0xd9, 0xaf, 0xa2, 0x69, 0x0a, 0x4f, 0x5b, 0x4d, 0x2c, 0xe5, + 0x68, 0x0d, 0x8a, 0x32, 0xa7, 0xeb, 0x94, 0xbf, 0xa8, 0xf5, 0x45, 0x95, 0x91, 0x94, 0x06, 0x7d, + 0x3b, 0x9d, 0xbf, 0xda, 0x74, 0x1e, 0xef, 0xec, 0xe5, 0xec, 0x7c, 0xb4, 0x0a, 0x4f, 0x62, 0xd1, + 0x16, 0x14, 0x6d, 0xd2, 0x67, 0x3a, 0x8f, 0xd5, 0xce, 0x5a, 0x73, 0xbe, 0xa8, 0x45, 0xd1, 0x28, + 0x85, 0x58, 0xb1, 0x58, 0x7f, 0x90, 0x19, 0x3e, 0xbf, 0xe2, 0xff, 0x7d, 0x85, 0xf7, 0xa0, 0xe2, + 0x30, 0xd1, 0x77, 0xc9, 0x70, 0x5a, 0x29, 0x6b, 0xa6, 0x2a, 0x9c, 0xc5, 0xa1, 0xef, 0x64, 0x0a, + 0x6e, 0x51, 0xd9, 0xbc, 0x36, 0xa5, 0xe0, 0x2e, 0x3f, 0xf6, 0x45, 0xc0, 0xbc, 0xee, 0x94, 0x9a, + 0x7b, 0x13, 0x16, 0xfc, 0xf7, 0x3c, 0xca, 0x5b, 0x4d, 0x95, 0x91, 0xcb, 0xf5, 0x65, 0x6d, 0xbf, + 0xb0, 0x1b, 0x89, 0x71, 0xac, 0x97, 0xe5, 0x59, 0xfd, 0x94, 0x05, 0xc8, 0x9c, 0xcf, 0x97, 0xe7, + 0xdd, 0x58, 0x81, 0x53, 0x8c, 0x5c, 0x13, 0xe9, 0xb3, 0x4d, 0xcf, 0xe9, 0xfb, 0xcc, 0x0b, 0xcc, + 0x85, 0xfc, 0x9a, 0x36, 0xda, 0xad, 0x58, 0x85, 0xb3, 0x38, 0xf4, 0x3a, 0x94, 0x6c, 0x52, 0x0f, + 0x3d, 0xc7, 0xa5, 0x66, 0x49, 0xd9, 0x5c, 0x8c, 0xd7, 0xd4, 0xd8, 0x88, 0xe4, 0x38, 0x41, 0xc8, + 0x59, 0xf5, 0xa2, 0x73, 0x6e, 0x35, 0xcd, 0x72, 0x7e, 0x56, 0xdb, 0xb1, 0x02, 0xa7, 0x18, 0x74, + 0x1f, 0x16, 0x0f, 0xc3, 0xfd, 0xf8, 0x80, 0x9b, 0x26, 0x28, 0x9b, 0x15, 0x6d, 0xb3, 0xf8, 0x38, + 0xa3, 0xc3, 0x39, 0x24, 0x6a, 0xc3, 0x8a, 0xed, 0xfa, 0xa1, 0xd3, 0xa1, 0x7c, 0xc0, 0x6c, 0xba, + 0x11, 0x06, 0x87, 0xdb, 0xbe, 0x43, 0x55, 0x52, 0x2d, 0xd7, 0x5f, 0xd5, 0x0c, 0x2b, 0x8d, 0x29, + 0x18, 0x3c, 0xd5, 0x12, 0xad, 0x43, 0xb1, 0x27, 0x19, 0x16, 0x15, 0xc3, 0x17, 0x63, 0xbf, 0x90, + 0xba, 0xe3, 0xb4, 0x83, 0x51, 0x04, 0x0a, 0x28, 0x8b, 0xb2, 0xcb, 0x6c, 0xea, 0x09, 0x6a, 0x2e, + 0x9d, 0x2b, 0x80, 0xb7, 0x22, 0xb4, 0x72, 0x64, 0x55, 0x94, 0xb5, 0x00, 0xc7, 0x3c, 0xd6, 0xbf, + 0x0b, 0x50, 0x6e, 0xf8, 0x9e, 0xc3, 0x54, 0x21, 0xbd, 0x0d, 0xc5, 0x40, 0x9e, 0x6f, 0xe4, 0x4c, + 0xd7, 0xe2, 0x19, 0xc9, 0xf3, 0x3c, 0x1e, 0x55, 0x97, 0x12, 0xa0, 0x3a, 0x6b, 0x05, 0x45, 0x3f, + 0x84, 0x79, 0x11, 0x90, 0x20, 0x14, 0xda, 0x83, 0x1e, 0x6a, 0xa3, 0xf9, 0x8e, 0x92, 0x1e, 0x8f, + 0xaa, 0xe7, 0x6a, 0x30, 0x6b, 0x09, 0x77, 0x64, 0x87, 0x35, 0x2b, 0x7a, 0x03, 0x90, 0xbf, 0x2f, + 0x28, 0x1f, 0x50, 0xe7, 0x51, 0xd4, 0x83, 0xca, 0xfe, 0x41, 0x46, 0x48, 0xa1, 0x7e, 0x55, 0x8f, + 0x85, 0x76, 0x4f, 0x20, 0xf0, 0x14, 0x2b, 0xb4, 0x01, 0x25, 0x41, 0x07, 0x94, 0xb3, 0x60, 0xa8, + 0x5d, 0xf8, 0xcb, 0xb1, 0x6f, 0x75, 0xb4, 0xfc, 0x78, 0x54, 0xbd, 0x94, 0x4e, 0x45, 0x0b, 0x71, + 0x62, 0x86, 0x06, 0x80, 0x5c, 0x22, 0x82, 0x3d, 0x4e, 0x3c, 0x11, 0x6d, 0x05, 0xeb, 0x51, 0x73, + 0x21, 0x3e, 0x8d, 0xf3, 0x74, 0x1c, 0xd2, 0x22, 0x9d, 0xfa, 0xd6, 0x09, 0x36, 0x3c, 0x65, 0x04, + 0x74, 0x1d, 0xe6, 0x39, 0x25, 0xc2, 0xf7, 0x74, 0x50, 0x5c, 0x88, 0xb7, 0x19, 0x2b, 0x29, 0xd6, + 0x5a, 0x19, 0xd1, 0x3d, 0x2a, 0x04, 0xe9, 0x52, 0xb3, 0x9c, 0x8f, 0xe8, 0xed, 0x48, 0x8c, 0x63, + 0xbd, 0xf5, 0x0f, 0x03, 0x96, 0x1f, 0x53, 0xe2, 0x06, 0x87, 0x8d, 0x43, 0x6a, 0x1f, 0xa9, 0x5e, + 0xf5, 0x17, 0x06, 0x5c, 0xe1, 0x94, 0x38, 0xbe, 0xe7, 0x0e, 0x27, 0x74, 0xba, 0x66, 0x7c, 0xfd, + 0x0c, 0x97, 0xc3, 0xd3, 0xad, 0xeb, 0x55, 0x3d, 0x8f, 0x2b, 0xa7, 0x00, 0xf0, 0x69, 0xe3, 0xa2, + 0x47, 0x70, 0x49, 0xd7, 0xca, 0x37, 0x39, 0x0b, 0xa8, 0x52, 0xa8, 0x5c, 0x5a, 0xaa, 0xbf, 0xa2, + 0x49, 0x2f, 0x35, 0x27, 0x01, 0xf8, 0xa4, 0x8d, 0xf5, 0x2f, 0x03, 0xca, 0xad, 0x1e, 0xe9, 0xaa, + 0x78, 0x90, 0x6d, 0x39, 0x93, 0x1f, 0x93, 0x6d, 0xb9, 0x42, 0xe0, 0x48, 0x87, 0xf6, 0xa0, 0xe4, + 0x32, 0x8f, 0x92, 0xae, 0xee, 0x10, 0x2a, 0x77, 0xae, 0x9f, 0x19, 0x72, 0x0a, 0x9e, 0x66, 0x2d, + 0x2d, 0x10, 0x38, 0x61, 0x92, 0x05, 0xb9, 0x1f, 0xba, 0x6e, 0x83, 0x53, 0x87, 0x7a, 0x01, 0x23, + 0xae, 0x30, 0x0b, 0xe7, 0x2a, 0x4e, 0xed, 0xbc, 0x55, 0x54, 0x00, 0x27, 0x84, 0x78, 0x92, 0xdb, + 0xfa, 0xb5, 0x01, 0x95, 0x4c, 0x26, 0x40, 0x4f, 0x54, 0xb5, 0x09, 0x38, 0xdb, 0x0f, 0x03, 0x3f, + 0xbe, 0xaa, 0xdd, 0xcc, 0x54, 0x9b, 0x58, 0x25, 0xaf, 0x3b, 0xda, 0x30, 0x23, 0xc5, 0x59, 0x6b, + 0x99, 0xaf, 0x69, 0x9c, 0xe3, 0x67, 0xf3, 0xf9, 0x3a, 0x49, 0xf0, 0x09, 0x42, 0x6e, 0xba, 0xcf, + 0xbb, 0xad, 0xa6, 0x59, 0xc8, 0x6f, 0xfa, 0xae, 0x14, 0xe2, 0x48, 0x67, 0xfd, 0xcc, 0x80, 0x05, + 0xbd, 0x6b, 0x68, 0x07, 0xe6, 0xec, 0x43, 0xc2, 0x3c, 0xdd, 0x36, 0xde, 0x3c, 0x63, 0x83, 0xa2, + 0x4b, 0x91, 0xca, 0x77, 0x09, 0x77, 0x43, 0xda, 0xe3, 0x88, 0x06, 0xd5, 0x00, 0x6c, 0xdf, 0x0b, + 0x88, 0x8c, 0xcd, 0xb8, 0xe9, 0x53, 0xad, 0x6d, 0x23, 0x91, 0xe2, 0x0c, 0xc2, 0xfa, 0x95, 0x01, + 0x25, 0x4d, 0xda, 0x94, 0xb3, 0xef, 0x72, 0x3f, 0xec, 0x4f, 0xba, 0xcc, 0x23, 0x29, 0xc4, 0x91, + 0x4e, 0x56, 0xfb, 0x23, 0xe6, 0x39, 0x93, 0xd5, 0xfe, 0x09, 0xf3, 0x1c, 0xac, 0x34, 0xf9, 0x9b, + 0x6e, 0xe1, 0x1c, 0x37, 0xdd, 0xb8, 0x81, 0x28, 0x9e, 0xd6, 0x40, 0x58, 0xbf, 0x31, 0x00, 0xd2, + 0xb5, 0xa3, 0x37, 0xa1, 0xc4, 0xa9, 0xf0, 0x43, 0x6e, 0x53, 0x1d, 0xb6, 0x37, 0xcf, 0x0c, 0xdb, + 0x08, 0xde, 0x6a, 0xa6, 0xe7, 0x17, 0xcb, 0x70, 0x42, 0x86, 0xb6, 0xa1, 0xc0, 0x93, 0x0b, 0x6a, + 0xed, 0x5c, 0x87, 0x91, 0xde, 0x50, 0x93, 0xce, 0x48, 0xde, 0x4f, 0x25, 0x8f, 0xe5, 0xc0, 0xf2, + 0x04, 0x28, 0xbf, 0x39, 0xc6, 0x67, 0xd8, 0x9c, 0x53, 0xbb, 0x2b, 0xeb, 0xef, 0x06, 0x4c, 0x06, + 0xc9, 0x67, 0x1f, 0xe6, 0x0d, 0x40, 0x42, 0xd7, 0x6f, 0xdb, 0xf6, 0x43, 0x2f, 0xd8, 0x49, 0x07, + 0x4d, 0x92, 0x79, 0xe7, 0x04, 0x02, 0x4f, 0xb1, 0x42, 0x3f, 0x88, 0x2f, 0xe4, 0x98, 0x1e, 0x44, + 0xbd, 0x6c, 0xe5, 0xce, 0x8d, 0x69, 0xb7, 0xfd, 0xa9, 0x17, 0xfd, 0x89, 0xab, 0xbb, 0xe4, 0xc0, + 0x19, 0x3e, 0xeb, 0x85, 0x01, 0xa7, 0x25, 0x59, 0xf4, 0x0d, 0x58, 0xea, 0x53, 0xce, 0x7c, 0xa7, + 0x43, 0x6d, 0xdf, 0x73, 0xa2, 0x37, 0x89, 0xb9, 0xfa, 0xa5, 0xf1, 0xa8, 0xba, 0xd4, 0xce, 0x2a, + 0x70, 0x1e, 0x27, 0x2f, 0xa1, 0x01, 0xeb, 0x51, 0x3f, 0x0c, 0x62, 0xcb, 0x59, 0x65, 0xa9, 0x2e, + 0xa1, 0x7b, 0x39, 0x0d, 0x9e, 0x40, 0xca, 0xab, 0xd1, 0x01, 0x61, 0x6e, 0xc8, 0xe9, 0xde, 0x21, + 0xa7, 0xe2, 0xd0, 0x77, 0x1d, 0xe5, 0xf6, 0x73, 0xd1, 0xd5, 0xe8, 0xe1, 0x84, 0x0e, 0x9f, 0x40, + 0x5b, 0x7f, 0x32, 0x00, 0x52, 0x0f, 0x3d, 0x5f, 0x1c, 0xde, 0x84, 0x85, 0x01, 0xe5, 0x42, 0x76, + 0x0b, 0xb3, 0xf9, 0x4a, 0xf8, 0xfd, 0x48, 0x8c, 0x63, 0x7d, 0xe2, 0x42, 0x85, 0x53, 0x1b, 0xf4, + 0x38, 0xa8, 0x8b, 0xa7, 0x06, 0xf5, 0x5d, 0x98, 0x13, 0xb6, 0xdf, 0xa7, 0xba, 0x0d, 0x5a, 0x8d, + 0xe7, 0xd4, 0xb1, 0xfd, 0xa8, 0x79, 0x8a, 0xe7, 0xaf, 0x04, 0x38, 0x02, 0x5b, 0x7f, 0x34, 0xa0, + 0xbc, 0xb7, 0xd5, 0x69, 0xf8, 0xde, 0x01, 0xeb, 0xe6, 0x1f, 0x81, 0x8c, 0xcf, 0xf7, 0x11, 0xe8, + 0x10, 0x16, 0xed, 0xf4, 0x62, 0x1f, 0x57, 0xb3, 0xda, 0xf9, 0xdf, 0x02, 0x54, 0x15, 0x4f, 0x1a, + 0xe5, 0x8c, 0x42, 0xe0, 0x1c, 0xb3, 0xf5, 0x25, 0x28, 0x4b, 0x87, 0xd8, 0x3d, 0x68, 0x92, 0xe1, + 0x83, 0x95, 0x5f, 0x7e, 0x5c, 0x9d, 0xf9, 0xe9, 0xb3, 0xea, 0xcc, 0x47, 0xcf, 0xaa, 0x33, 0x1f, + 0x3f, 0xab, 0xce, 0x7c, 0xf8, 0x97, 0xb5, 0x19, 0xeb, 0x5d, 0x58, 0x52, 0x2d, 0x64, 0x12, 0xf5, + 0xaf, 0x43, 0x89, 0xf4, 0xd9, 0xa3, 0xcc, 0xa1, 0x26, 0x59, 0x68, 0xa3, 0xdd, 0x8a, 0xce, 0x35, + 0x41, 0x9c, 0x9d, 0x62, 0xad, 0xdf, 0x19, 0xb0, 0xa2, 0x76, 0x69, 0x32, 0xbd, 0x7c, 0xce, 0x03, + 0xfd, 0x3f, 0x72, 0xf9, 0xef, 0x0b, 0x50, 0xc9, 0xbc, 0xa6, 0xc9, 0x98, 0xf5, 0x79, 0x97, 0x78, + 0xec, 0x03, 0xd5, 0xc5, 0x46, 0x2f, 0x28, 0xe5, 0x28, 0x66, 0x77, 0xb3, 0x0a, 0x9c, 0xc7, 0xa1, + 0xaf, 0x42, 0x59, 0xe5, 0x1c, 0xce, 0x92, 0xf7, 0x0d, 0xe5, 0x1f, 0x8d, 0x58, 0x88, 0x53, 0x3d, + 0x6a, 0xc1, 0xe5, 0xac, 0x35, 0x71, 0x9f, 0x7a, 0x2c, 0x88, 0x2f, 0xda, 0x57, 0xc6, 0xa3, 0xea, + 0xe5, 0xdd, 0x93, 0x6a, 0x3c, 0xcd, 0x46, 0xd6, 0x58, 0x57, 0x3a, 0x27, 0x0b, 0xe4, 0xc0, 0xc5, + 0xb4, 0xc6, 0x6e, 0x25, 0x52, 0x9c, 0x41, 0xc8, 0x79, 0xaa, 0x1b, 0xa9, 0x67, 0x53, 0x79, 0x8b, + 0x48, 0xe6, 0xd9, 0x8e, 0x85, 0x38, 0xd5, 0xcb, 0xc7, 0x00, 0x11, 0x70, 0x4a, 0x83, 0xf4, 0x39, + 0x6c, 0x3e, 0x7d, 0x0c, 0xe8, 0xe4, 0x55, 0x78, 0x12, 0x2b, 0x5f, 0xe7, 0xfa, 0xbe, 0x08, 0x88, + 0xdb, 0xf0, 0x9d, 0xe4, 0x29, 0x4f, 0xbd, 0xce, 0xb5, 0x53, 0x31, 0xce, 0x62, 0xe4, 0x95, 0x51, + 0x50, 0xce, 0x88, 0xbb, 0x13, 0xf6, 0xf6, 0x29, 0xd7, 0x0d, 0x78, 0x12, 0x09, 0x9d, 0x8c, 0x0e, + 0xe7, 0x90, 0xf5, 0xc6, 0xf3, 0x97, 0xab, 0x33, 0x2f, 0x5e, 0xae, 0xce, 0x7c, 0xf2, 0x72, 0x75, + 0xe6, 0xc3, 0xf1, 0xaa, 0xf1, 0x7c, 0xbc, 0x6a, 0xbc, 0x18, 0xaf, 0x1a, 0x9f, 0x8c, 0x57, 0x8d, + 0xbf, 0x8e, 0x57, 0x8d, 0x8f, 0xfe, 0xb6, 0x3a, 0xf3, 0xf6, 0xb5, 0x4f, 0xfd, 0x87, 0xe0, 0x3f, + 0x03, 0x00, 0x83, 0x5d, 0xa6, 0x72, 0x41, 0x18, 0x00, 0x00, } func (m *CAPIClusterInfo) Marshal() (dAtA []byte, err error) { @@ -1191,6 +1225,18 @@ func (m *ClusterMetadata) MarshalToSizedBuffer(dAtA []byte) (int, error) { _ = i var l int _ = l + if m.License != nil { + { + size, err := m.License.MarshalToSizedBuffer(dAtA[:i]) + if err != nil { + return 0, err + } + i -= size + i = encodeVarintGenerated(dAtA, i, uint64(size)) + } + i-- + dAtA[i] = 0x6a + } i -= len(m.Mode) copy(dAtA[i:], m.Mode) i = encodeVarintGenerated(dAtA, i, uint64(len(m.Mode))) @@ -1410,6 +1456,44 @@ func (m *ImageInfo) MarshalToSizedBuffer(dAtA []byte) (int, error) { return len(dAtA) - i, nil } +func (m *LicenseInfo) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalToSizedBuffer(dAtA[:size]) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *LicenseInfo) MarshalTo(dAtA []byte) (int, error) { + size := m.Size() + return m.MarshalToSizedBuffer(dAtA[:size]) +} + +func (m *LicenseInfo) MarshalToSizedBuffer(dAtA []byte) (int, error) { + i := len(dAtA) + _ = i + var l int + _ = l + i -= len(m.OrgID) + copy(dAtA[i:], m.OrgID) + i = encodeVarintGenerated(dAtA, i, uint64(len(m.OrgID))) + i-- + dAtA[i] = 0x1a + i -= len(m.Endpoint) + copy(dAtA[i:], m.Endpoint) + i = encodeVarintGenerated(dAtA, i, uint64(len(m.Endpoint))) + i-- + dAtA[i] = 0x12 + i -= len(m.Distributor) + copy(dAtA[i:], m.Distributor) + i = encodeVarintGenerated(dAtA, i, uint64(len(m.Distributor))) + i-- + dAtA[i] = 0xa + return len(dAtA) - i, nil +} + func (m *Lineage) Marshal() (dAtA []byte, err error) { size := m.Size() dAtA = make([]byte, size) @@ -2111,6 +2195,10 @@ func (m *ClusterMetadata) Size() (n int) { n += 1 + l + sovGenerated(uint64(l)) l = len(m.Mode) n += 1 + l + sovGenerated(uint64(l)) + if m.License != nil { + l = m.License.Size() + n += 1 + l + sovGenerated(uint64(l)) + } return n } @@ -2169,6 +2257,21 @@ func (m *ImageInfo) Size() (n int) { return n } +func (m *LicenseInfo) Size() (n int) { + if m == nil { + return 0 + } + var l int + _ = l + l = len(m.Distributor) + n += 1 + l + sovGenerated(uint64(l)) + l = len(m.Endpoint) + n += 1 + l + sovGenerated(uint64(l)) + l = len(m.OrgID) + n += 1 + l + sovGenerated(uint64(l)) + return n +} + func (m *Lineage) Size() (n int) { if m == nil { return 0 @@ -2501,6 +2604,7 @@ func (this *ClusterMetadata) String() string { `HubClusterID:` + fmt.Sprintf("%v", this.HubClusterID) + `,`, `CloudServiceAuthMode:` + fmt.Sprintf("%v", this.CloudServiceAuthMode) + `,`, `Mode:` + fmt.Sprintf("%v", this.Mode) + `,`, + `License:` + strings.Replace(this.License.String(), "LicenseInfo", "LicenseInfo", 1) + `,`, `}`, }, "") return s @@ -2549,6 +2653,18 @@ func (this *ImageInfo) String() string { }, "") return s } +func (this *LicenseInfo) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&LicenseInfo{`, + `Distributor:` + fmt.Sprintf("%v", this.Distributor) + `,`, + `Endpoint:` + fmt.Sprintf("%v", this.Endpoint) + `,`, + `OrgID:` + fmt.Sprintf("%v", this.OrgID) + `,`, + `}`, + }, "") + return s +} func (this *Lineage) String() string { if this == nil { return "nil" @@ -4277,6 +4393,42 @@ func (m *ClusterMetadata) Unmarshal(dAtA []byte) error { } m.Mode = ClusterMode(dAtA[iNdEx:postIndex]) iNdEx = postIndex + case 13: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field License", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= int(b&0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex < 0 { + return ErrInvalidLengthGenerated + } + if postIndex > l { + return io.ErrUnexpectedEOF + } + if m.License == nil { + m.License = &LicenseInfo{} + } + if err := m.License.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -4815,6 +4967,152 @@ func (m *ImageInfo) Unmarshal(dAtA []byte) error { } return nil } +func (m *LicenseInfo) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= uint64(b&0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: LicenseInfo: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: LicenseInfo: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Distributor", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= uint64(b&0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex < 0 { + return ErrInvalidLengthGenerated + } + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.Distributor = LicenseDistributor(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 2: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Endpoint", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= uint64(b&0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex < 0 { + return ErrInvalidLengthGenerated + } + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.Endpoint = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 3: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field OrgID", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= uint64(b&0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex < 0 { + return ErrInvalidLengthGenerated + } + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.OrgID = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if (skippy < 0) || (iNdEx+skippy) < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} func (m *Lineage) Unmarshal(dAtA []byte) error { l := len(dAtA) iNdEx := 0 diff --git a/vendor/kmodules.xyz/client-go/api/v1/generated.proto b/vendor/kmodules.xyz/client-go/api/v1/generated.proto index dc1b76e3d..c1730f3c1 100644 --- a/vendor/kmodules.xyz/client-go/api/v1/generated.proto +++ b/vendor/kmodules.xyz/client-go/api/v1/generated.proto @@ -55,7 +55,7 @@ message CertificateSpec { // IssuerRef is a reference to a Certificate Issuer. // +optional - optional k8s.io.api.core.v1.TypedLocalObjectReference issuerRef = 2; + optional .k8s.io.api.core.v1.TypedLocalObjectReference issuerRef = 2; // Specifies the k8s secret name that holds the certificates. // Default to --cert. @@ -68,7 +68,7 @@ message CertificateSpec { // Certificate default Duration // +optional - optional k8s.io.apimachinery.pkg.apis.meta.v1.Duration duration = 5; + optional .k8s.io.apimachinery.pkg.apis.meta.v1.Duration duration = 5; // Certificate renew before expiration duration // @@ -76,7 +76,7 @@ message CertificateSpec { // // +deprecated // +optional - optional k8s.io.apimachinery.pkg.apis.meta.v1.Duration renewBefore = 6; + optional .k8s.io.apimachinery.pkg.apis.meta.v1.Duration renewBefore = 6; // DNSNames is a list of subject alt names to be used on the Certificate. // +optional @@ -147,6 +147,8 @@ message ClusterMetadata { optional string cloudServiceAuthMode = 11; optional string mode = 12; + + optional LicenseInfo license = 13; } // Condition defines an observation of a object operational state. @@ -174,7 +176,7 @@ message Condition { // Last time the condition transitioned from one status to another. // This should be when the underlying condition changed. If that is not known, then using the time when // the API field changed is acceptable. - optional k8s.io.apimachinery.pkg.apis.meta.v1.Time lastTransitionTime = 7; + optional .k8s.io.apimachinery.pkg.apis.meta.v1.Time lastTransitionTime = 7; // The reason for the condition's last transition in CamelCase. // The specific API may choose whether this field is considered a guaranteed API. @@ -206,6 +208,15 @@ message ImageInfo { optional PullCredentials pullCredentials = 3; } +message LicenseInfo { + optional string distributor = 1; + + // Endpoint is the platform-api to acquire licenses from, when Distributor is selfhosted. + optional string endpoint = 2; + + optional string orgID = 3; +} + message Lineage { repeated ObjectInfo chain = 1; @@ -245,7 +256,7 @@ message PullCredentials { optional string serviceAccountName = 2; - repeated k8s.io.api.core.v1.LocalObjectReference secretRefs = 3; + repeated .k8s.io.api.core.v1.LocalObjectReference secretRefs = 3; } // ReadonlyHealthCheckSpec defines attributes of the health check using only read-only checks @@ -289,7 +300,7 @@ message ResourceID { message TLSConfig { // IssuerRef is a reference to a Certificate Issuer. // +optional - optional k8s.io.api.core.v1.TypedLocalObjectReference issuerRef = 1; + optional .k8s.io.api.core.v1.TypedLocalObjectReference issuerRef = 1; // Certificate provides server and/or client certificate options used by application pods. // These options are passed to a cert-manager Certificate object. diff --git a/vendor/kmodules.xyz/client-go/api/v1/openapi_generated.go b/vendor/kmodules.xyz/client-go/api/v1/openapi_generated.go index e33f37561..660923946 100644 --- a/vendor/kmodules.xyz/client-go/api/v1/openapi_generated.go +++ b/vendor/kmodules.xyz/client-go/api/v1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1 import ( @@ -30,12 +28,17 @@ import ( func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenAPIDefinition { return map[string]common.OpenAPIDefinition{ + "kmodules.xyz/client-go/api/v1.CAPIClusterInfo": schema_kmodulesxyz_client_go_api_v1_CAPIClusterInfo(ref), "kmodules.xyz/client-go/api/v1.CertificatePrivateKey": schema_kmodulesxyz_client_go_api_v1_CertificatePrivateKey(ref), "kmodules.xyz/client-go/api/v1.CertificateSpec": schema_kmodulesxyz_client_go_api_v1_CertificateSpec(ref), + "kmodules.xyz/client-go/api/v1.ClusterClaimFeatures": schema_kmodulesxyz_client_go_api_v1_ClusterClaimFeatures(ref), + "kmodules.xyz/client-go/api/v1.ClusterClaimInfo": schema_kmodulesxyz_client_go_api_v1_ClusterClaimInfo(ref), + "kmodules.xyz/client-go/api/v1.ClusterInfo": schema_kmodulesxyz_client_go_api_v1_ClusterInfo(ref), "kmodules.xyz/client-go/api/v1.ClusterMetadata": schema_kmodulesxyz_client_go_api_v1_ClusterMetadata(ref), "kmodules.xyz/client-go/api/v1.Condition": schema_kmodulesxyz_client_go_api_v1_Condition(ref), "kmodules.xyz/client-go/api/v1.HealthCheckSpec": schema_kmodulesxyz_client_go_api_v1_HealthCheckSpec(ref), "kmodules.xyz/client-go/api/v1.ImageInfo": schema_kmodulesxyz_client_go_api_v1_ImageInfo(ref), + "kmodules.xyz/client-go/api/v1.LicenseInfo": schema_kmodulesxyz_client_go_api_v1_LicenseInfo(ref), "kmodules.xyz/client-go/api/v1.Lineage": schema_kmodulesxyz_client_go_api_v1_Lineage(ref), "kmodules.xyz/client-go/api/v1.ObjectID": schema_kmodulesxyz_client_go_api_v1_ObjectID(ref), "kmodules.xyz/client-go/api/v1.ObjectInfo": schema_kmodulesxyz_client_go_api_v1_ObjectInfo(ref), @@ -45,12 +48,47 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kmodules.xyz/client-go/api/v1.ResourceID": schema_kmodulesxyz_client_go_api_v1_ResourceID(ref), "kmodules.xyz/client-go/api/v1.TLSConfig": schema_kmodulesxyz_client_go_api_v1_TLSConfig(ref), "kmodules.xyz/client-go/api/v1.TimeOfDay": schema_kmodulesxyz_client_go_api_v1_TimeOfDay(ref), + "kmodules.xyz/client-go/api/v1.TypeReference": schema_kmodulesxyz_client_go_api_v1_TypeReference(ref), "kmodules.xyz/client-go/api/v1.TypedObjectReference": schema_kmodulesxyz_client_go_api_v1_TypedObjectReference(ref), "kmodules.xyz/client-go/api/v1.X509Subject": schema_kmodulesxyz_client_go_api_v1_X509Subject(ref), "kmodules.xyz/client-go/api/v1.stringSetMerger": schema_kmodulesxyz_client_go_api_v1_stringSetMerger(ref), } } +func schema_kmodulesxyz_client_go_api_v1_CAPIClusterInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "provider": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "clusterName": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"provider", "namespace", "clusterName"}, + }, + }, + } +} + func schema_kmodulesxyz_client_go_api_v1_CertificatePrivateKey(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -112,7 +150,7 @@ func schema_kmodulesxyz_client_go_api_v1_CertificateSpec(ref common.ReferenceCal }, "renewBefore": { SchemaProps: spec.SchemaProps{ - Description: "Certificate renew before expiration duration", + Description: "Certificate renew before expiration duration\n\nDeprecated use `ReconfigureTLS` type OpsRequest instead.", Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), }, }, @@ -191,6 +229,131 @@ func schema_kmodulesxyz_client_go_api_v1_CertificateSpec(ref common.ReferenceCal } } +func schema_kmodulesxyz_client_go_api_v1_ClusterClaimFeatures(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "enabledFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "externallyManagedFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "disabledFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterClaimInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "clusterMetadata": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ClusterInfo"), + }, + }, + }, + Required: []string{"clusterMetadata"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.ClusterInfo"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ClusterInfo used in ace-installer", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "uid": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "clusterManagers": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "capi": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/client-go/api/v1.CAPIClusterInfo"), + }, + }, + }, + Required: []string{"uid", "name", "clusterManagers"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.CAPIClusterInfo"}, + } +} + func schema_kmodulesxyz_client_go_api_v1_ClusterMetadata(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -222,10 +385,65 @@ func schema_kmodulesxyz_client_go_api_v1_ClusterMetadata(ref common.ReferenceCal Format: "", }, }, + "ownerID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "ownerType": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "apiEndpoint": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "caBundle": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "managerID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "hubClusterID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "cloudServiceAuthMode": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "mode": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "license": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/client-go/api/v1.LicenseInfo"), + }, + }, }, Required: []string{"uid"}, }, }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.LicenseInfo"}, } } @@ -269,7 +487,6 @@ func schema_kmodulesxyz_client_go_api_v1_Condition(ref common.ReferenceCallback) "lastTransitionTime": { SchemaProps: spec.SchemaProps{ Description: "Last time the condition transitioned from one status to another. This should be when the underlying condition changed. If that is not known, then using the time when the API field changed is acceptable.", - Default: map[string]interface{}{}, Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), }, }, @@ -377,6 +594,37 @@ func schema_kmodulesxyz_client_go_api_v1_ImageInfo(ref common.ReferenceCallback) } } +func schema_kmodulesxyz_client_go_api_v1_LicenseInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "distributor": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "endpoint": { + SchemaProps: spec.SchemaProps{ + Description: "Endpoint is the platform-api to acquire licenses from, when Distributor is selfhosted.", + Type: []string{"string"}, + Format: "", + }, + }, + "orgID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + func schema_kmodulesxyz_client_go_api_v1_Lineage(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ @@ -678,11 +926,36 @@ func schema_kmodulesxyz_client_go_api_v1_TimeOfDay(ref common.ReferenceCallback) } } +func schema_kmodulesxyz_client_go_api_v1_TypeReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypeReference represents an object type.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiGroup": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + func schema_kmodulesxyz_client_go_api_v1_TypedObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ SchemaProps: spec.SchemaProps{ - Description: "TypedObjectReference represents an typed namespaced object.", + Description: "TypedObjectReference represents a typed namespaced object.", Type: []string{"object"}, Properties: map[string]spec.Schema{ "apiGroup": { diff --git a/vendor/kmodules.xyz/client-go/api/v1/zz_generated.deepcopy.go b/vendor/kmodules.xyz/client-go/api/v1/zz_generated.deepcopy.go index cacb9e1ce..5e7400d0b 100644 --- a/vendor/kmodules.xyz/client-go/api/v1/zz_generated.deepcopy.go +++ b/vendor/kmodules.xyz/client-go/api/v1/zz_generated.deepcopy.go @@ -198,6 +198,11 @@ func (in *ClusterInfo) DeepCopy() *ClusterInfo { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ClusterMetadata) DeepCopyInto(out *ClusterMetadata) { *out = *in + if in.License != nil { + in, out := &in.License, &out.License + *out = new(LicenseInfo) + **out = **in + } return } @@ -295,6 +300,22 @@ func (in *ImageInfo) DeepCopy() *ImageInfo { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *LicenseInfo) DeepCopyInto(out *LicenseInfo) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new LicenseInfo. +func (in *LicenseInfo) DeepCopy() *LicenseInfo { + if in == nil { + return nil + } + out := new(LicenseInfo) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *Lineage) DeepCopyInto(out *Lineage) { *out = *in diff --git a/vendor/kmodules.xyz/client-go/client/delegated.go b/vendor/kmodules.xyz/client-go/client/delegated.go index 6a4c4eca7..b1a1364e9 100644 --- a/vendor/kmodules.xyz/client-go/client/delegated.go +++ b/vendor/kmodules.xyz/client-go/client/delegated.go @@ -100,13 +100,38 @@ func (d *DelegatingClient) RestConfig() *restclient.Config { return d.config } +// aceExtraPrefix is the only extra-key namespace impersonated identities carry +// through. See impersonableExtra. +const aceExtraPrefix = "ace.appscode.com/" + +// impersonableExtra keeps only the ACE extras. Every other extra key is provider +// bookkeeping injected by the apiserver or the platform -- Rancher's principalid, +// EKS' arn, the reserved authentication.kubernetes.io/* keys -- and impersonating +// any of them needs an `impersonate` grant on userextras/ that callers do not +// hold, which fails the whole request during impersonation authorization. RBAC +// ignores extras, so dropping them changes no authorization decision. +func impersonableExtra(in map[string][]string) map[string][]string { + out := make(map[string][]string, len(in)) + for k, v := range in { + if strings.HasPrefix(k, aceExtraPrefix) { + out[k] = v + } + } + if len(out) == 0 { + return nil + } + return out +} + func (d *DelegatingClient) Impersonate(u user.Info) (*restclient.Config, client.Client, error) { + extra := impersonableExtra(u.GetExtra()) + config := restclient.CopyConfig(d.config) config.Impersonate = restclient.ImpersonationConfig{ UserName: u.GetName(), UID: u.GetUID(), Groups: u.GetGroups(), - Extra: u.GetExtra(), + Extra: extra, } // share the transport between all clients @@ -117,7 +142,7 @@ func (d *DelegatingClient) Impersonate(u user.Info) (*restclient.Config, client. UserName: u.GetName(), UID: u.GetUID(), Groups: u.GetGroups(), - Extra: u.GetExtra(), + Extra: extra, }, d.options.HTTPClient.Transport), } } diff --git a/vendor/kmodules.xyz/client-go/cluster/lib.go b/vendor/kmodules.xyz/client-go/cluster/lib.go index 86fe1aa93..e1ceca0a9 100644 --- a/vendor/kmodules.xyz/client-go/cluster/lib.go +++ b/vendor/kmodules.xyz/client-go/cluster/lib.go @@ -109,6 +109,14 @@ func ClusterMetadataFromConfigMap(cm *core.ConfigMap, mode kmapi.ClusterMode, cl CABundle: cm.Data["ca.crt"], CloudServiceAuthMode: cm.Data["cloudServiceAuthMode"], } + li := kmapi.LicenseInfo{ + Distributor: kmapi.LicenseDistributor(cm.Data["licenseDistributor"]), + Endpoint: cm.Data["licenseEndpoint"], + OrgID: cm.Data["licenseOrgID"], + } + if !li.IsEmpty() { + md.License = &li + } data, err := json.Marshal(md) if err != nil { @@ -137,7 +145,17 @@ func UpsertClusterMetadata(kc client.Client, md *kmapi.ClusterMetadata) error { }, } - data, err := json.Marshal(md) + // an all-empty License must sign as absent, so a reader that finds no license + // keys in the ConfigMap reconstructs the same payload the mac was taken over + signed := *md + var li kmapi.LicenseInfo + if signed.License.IsEmpty() { + signed.License = nil + } else { + li = *signed.License + } + + data, err := json.Marshal(signed) if err != nil { return err } @@ -160,6 +178,9 @@ func UpsertClusterMetadata(kc client.Client, md *kmapi.ClusterMetadata) error { cm.Data["apiEndpoint"] = md.APIEndpoint cm.Data["ca.crt"] = md.CABundle cm.Data["cloudServiceAuthMode"] = md.CloudServiceAuthMode + cm.Data["licenseDistributor"] = string(li.Distributor) + cm.Data["licenseEndpoint"] = li.Endpoint + cm.Data["licenseOrgID"] = li.OrgID cm.BinaryData = map[string][]byte{ "mac": messageMAC, diff --git a/vendor/kmodules.xyz/client-go/cluster/ocm.go b/vendor/kmodules.xyz/client-go/cluster/ocm.go index 755270809..afcd1c6c3 100644 --- a/vendor/kmodules.xyz/client-go/cluster/ocm.go +++ b/vendor/kmodules.xyz/client-go/cluster/ocm.go @@ -50,8 +50,9 @@ func IsOpenClusterSpoke(kc client.Reader) bool { err := kc.List(context.TODO(), &list) if err != nil { if !meta.IsNoMatchError(err) && !apierrors.IsNotFound(err) { - panic(err) // panic if 403 (missing rbac) + klog.Errorln(err) // eg, 403 (missing rbac) } + return false } return len(list.Items) > 0 } diff --git a/vendor/kmodules.xyz/client-go/cluster/openshift.go b/vendor/kmodules.xyz/client-go/cluster/openshift.go index 1aa499646..22c1b6ef9 100644 --- a/vendor/kmodules.xyz/client-go/cluster/openshift.go +++ b/vendor/kmodules.xyz/client-go/cluster/openshift.go @@ -17,8 +17,25 @@ limitations under the License. package cluster import ( + "context" + "fmt" + + core "k8s.io/api/core/v1" "k8s.io/apimachinery/pkg/api/meta" + "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured" "k8s.io/apimachinery/pkg/runtime/schema" + "sigs.k8s.io/controller-runtime/pkg/client" +) + +const ( + OpenShiftClusterMonitoringNamespace = "openshift-monitoring" + OpenShiftClusterPrometheus = "k8s" + OpenShiftClusterAlertmanager = "main" + OpenShiftThanosQuerierService = "thanos-querier" + + OpenShiftUserWorkloadMonitoringNamespace = "openshift-user-workload-monitoring" + OpenShiftUserWorkloadPrometheus = "user-workload" + OpenShiftUserWorkloadAlertmanager = "user-workload" ) func IsOpenShiftManaged(mapper meta.RESTMapper) bool { @@ -30,3 +47,32 @@ func IsOpenShiftManaged(mapper meta.RESTMapper) bool { } return false } + +// GetOpenShiftAppsDomain fetches the default *.apps.. domain for OpenShift +func GetOpenShiftAppsDomain(kc client.Client) (string, error) { + var ing unstructured.Unstructured + ing.SetAPIVersion("operator.openshift.io/v1") + ing.SetKind("IngressController") + key := client.ObjectKey{Namespace: "openshift-ingress-operator", Name: "default"} + if err := kc.Get(context.Background(), key, &ing); err != nil { + return "", err + } + domain, found, err := unstructured.NestedString(ing.Object, "status", "domain") + if err != nil { + return "", err + } + if !found || domain == "" { + return "", fmt.Errorf("status.domain not found in IngressController") + } + return domain, nil +} + +// GetOpenShiftServiceSigner fetches the OpenShift service signer CA certificate +func GetOpenShiftServiceSigner(kc client.Client) ([]byte, error) { + var cm core.ConfigMap + err := kc.Get(context.TODO(), client.ObjectKey{Namespace: "kube-public", Name: "openshift-service-ca.crt"}, &cm) + if err != nil { + return nil, err + } + return []byte(cm.Data["service-ca.crt"]), nil +} diff --git a/vendor/kmodules.xyz/client-go/discovery/lib.go b/vendor/kmodules.xyz/client-go/discovery/lib.go index dd425b63c..800504361 100644 --- a/vendor/kmodules.xyz/client-go/discovery/lib.go +++ b/vendor/kmodules.xyz/client-go/discovery/lib.go @@ -223,7 +223,8 @@ func IsDefaultSupportedVersion(kc kubernetes.Interface) error { kc, DefaultConstraint, DefaultBlackListedVersions, - DefaultBlackListedMultiMasterVersions) + DefaultBlackListedMultiMasterVersions, + ) } func IsSupportedVersion(kc kubernetes.Interface, constraint string, blackListedVersions map[string]error, blackListedMultiMasterVersions map[string]error) error { diff --git a/vendor/kmodules.xyz/client-go/dynamic/kubernetes.go b/vendor/kmodules.xyz/client-go/dynamic/kubernetes.go index 584cc112b..6be3a2113 100644 --- a/vendor/kmodules.xyz/client-go/dynamic/kubernetes.go +++ b/vendor/kmodules.xyz/client-go/dynamic/kubernetes.go @@ -115,7 +115,8 @@ func untilHasKey( }, } - _, err = watchtools.UntilWithSync(ctx, + _, err = watchtools.UntilWithSync( + ctx, lw, &unstructured.Unstructured{}, nil, diff --git a/vendor/kmodules.xyz/client-go/gentype/fake.go b/vendor/kmodules.xyz/client-go/gentype/fake.go new file mode 100644 index 000000000..655abe14d --- /dev/null +++ b/vendor/kmodules.xyz/client-go/gentype/fake.go @@ -0,0 +1,55 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package gentype + +import ( + "context" + + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + "k8s.io/apimachinery/pkg/runtime" + "k8s.io/apimachinery/pkg/runtime/schema" + "k8s.io/client-go/testing" +) + +// FakeClient represents a fake create-only client for a runtime.Object type +// with no real persisted identity, matching Client's shape. +type FakeClient[T runtime.Object] struct { + *testing.Fake + ns string + resource schema.GroupVersionResource + kind schema.GroupVersionKind + newObject func() T +} + +// NewFakeClient constructs a fake create-only client, namespaced or not. +// Non-namespaced clients are constructed by passing an empty namespace (""). +func NewFakeClient[T runtime.Object]( + fake *testing.Fake, namespace string, resource schema.GroupVersionResource, kind schema.GroupVersionKind, emptyObjectCreator func() T, +) *FakeClient[T] { + return &FakeClient[T]{fake, namespace, resource, kind, emptyObjectCreator} +} + +// Create takes the representation of a resource and creates it. Returns the +// server's representation of the resource, and an error, if there is any. +func (c *FakeClient[T]) Create(ctx context.Context, resource T, opts metav1.CreateOptions) (result T, err error) { + emptyResult := c.newObject() + obj, err := c.Invokes(testing.NewCreateActionWithOptions(c.resource, c.ns, resource, opts), emptyResult) + if obj == nil { + return emptyResult, err + } + return obj.(T), err +} diff --git a/vendor/kmodules.xyz/client-go/gentype/type.go b/vendor/kmodules.xyz/client-go/gentype/type.go new file mode 100644 index 000000000..dbbe66648 --- /dev/null +++ b/vendor/kmodules.xyz/client-go/gentype/type.go @@ -0,0 +1,113 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Package gentype provides a generic, create-only client-go typed client +// for API types that are not real stored Kubernetes objects -- request/ +// response "action" payloads (e.g. an aggregated-apiserver endpoint that +// only ever accepts POST) which have no metav1.ObjectMeta and thus no real +// identity, labels, owner references, etc. +// +// k8s.io/client-go/gentype's Client[T] (which every generated client built +// since https://github.com/kubernetes/kubernetes/pull/121439 embeds) +// requires its type parameter to implement metav1.Object, even when the +// generated client only ever exposes Create -- Client[T].Create doesn't +// call any metav1.Object method on T, but the constraint is declared on the +// whole generic struct rather than per-method, so every type needs it +// regardless of which verbs its generated client actually has. +// +// This package provides the same shape (Client, NewClient, Option, +// PrefersProtobuf) but constrained to plain runtime.Object, for use by +// kmodules/code-generator's client-gen when it detects a +genclient type +// that is both create-only (+genclient:onlyVerbs=create, no other verb) and +// has no metav1.ObjectMeta member -- see cmd/client-gen/generators/util. +// IsCreateOnly/HasObjectMeta in that fork. Get/List/Update/Delete/Watch/ +// Patch/Apply all need real object identity and have no equivalent here; +// a type needing any of those must have a real metav1.ObjectMeta and use +// k8s.io/client-go/gentype directly instead. +package gentype + +import ( + "context" + + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + "k8s.io/apimachinery/pkg/runtime" + "k8s.io/client-go/rest" +) + +// Client represents a create-only client, optionally namespaced, for a +// runtime.Object type with no real persisted identity. +type Client[T runtime.Object] struct { + resource string + client rest.Interface + namespace string // "" for non-namespaced clients + newObject func() T + parameterCodec runtime.ParameterCodec + + prefersProtobuf bool +} + +// Option configures a Client. +type Option[T runtime.Object] func(*Client[T]) + +// PrefersProtobuf marks the client as preferring protobuf, matching +// k8s.io/client-go/gentype.PrefersProtobuf. +func PrefersProtobuf[T runtime.Object]() Option[T] { + return func(c *Client[T]) { c.prefersProtobuf = true } +} + +// NewClient constructs a create-only client, namespaced or not. Non- +// namespaced clients are constructed by passing an empty namespace (""). +func NewClient[T runtime.Object]( + resource string, client rest.Interface, parameterCodec runtime.ParameterCodec, namespace string, emptyObjectCreator func() T, + options ...Option[T], +) *Client[T] { + c := &Client[T]{ + resource: resource, + client: client, + parameterCodec: parameterCodec, + namespace: namespace, + newObject: emptyObjectCreator, + } + for _, option := range options { + option(c) + } + return c +} + +// GetClient returns the REST interface. +func (c *Client[T]) GetClient() rest.Interface { + return c.client +} + +// GetNamespace returns the client's namespace, if any. +func (c *Client[T]) GetNamespace() string { + return c.namespace +} + +// Create takes the representation of a resource and creates it. Returns the +// server's representation of the resource, and an error, if there is any. +func (c *Client[T]) Create(ctx context.Context, obj T, opts metav1.CreateOptions) (T, error) { + result := c.newObject() + err := c.client.Post(). + UseProtobufAsDefaultIfPreferred(c.prefersProtobuf). + NamespaceIfScoped(c.namespace, c.namespace != ""). + Resource(c.resource). + VersionedParams(&opts, c.parameterCodec). + Body(obj). + Do(ctx). + Into(result) + return result, err +} diff --git a/vendor/kmodules.xyz/client-go/meta/labels.go b/vendor/kmodules.xyz/client-go/meta/labels.go index 41b1bc21c..72c7208e7 100644 --- a/vendor/kmodules.xyz/client-go/meta/labels.go +++ b/vendor/kmodules.xyz/client-go/meta/labels.go @@ -16,31 +16,42 @@ limitations under the License. package meta -import metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" +import ( + "maps" + + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" +) func LabelsForLabelSelector(sel *metav1.LabelSelector) (map[string]string, bool) { - if sel != nil { - if len(sel.MatchExpressions) > 0 { - expr := sel.MatchExpressions[0] - switch expr.Operator { - case metav1.LabelSelectorOpIn: - return map[string]string{ - expr.Key: expr.Values[0], - }, false - case metav1.LabelSelectorOpNotIn: - return map[string]string{ - expr.Key: "not-" + expr.Values[0], - }, false - case metav1.LabelSelectorOpExists: - return map[string]string{ - expr.Key: "", - }, false - case metav1.LabelSelectorOpDoesNotExist: - return make(map[string]string), false + if sel == nil { + return make(map[string]string), true + } + + labels := make(map[string]string, len(sel.MatchLabels)+len(sel.MatchExpressions)) + maps.Copy(labels, sel.MatchLabels) + + for _, expr := range sel.MatchExpressions { + switch expr.Operator { + case metav1.LabelSelectorOpIn: + if len(expr.Values) > 0 { + labels[expr.Key] = expr.Values[0] + } + case metav1.LabelSelectorOpNotIn: + if len(expr.Values) > 0 { + v := expr.Values[0] + if v == "true" && len(expr.Values) == 1 { + labels[expr.Key] = "false" + } else if v == "false" && len(expr.Values) == 1 { + labels[expr.Key] = "true" + } else { + labels[expr.Key] = "not-" + v + } } - } else { - return sel.MatchLabels, true + case metav1.LabelSelectorOpExists: + labels[expr.Key] = "" + case metav1.LabelSelectorOpDoesNotExist: + delete(labels, expr.Key) } } - return make(map[string]string), true + return labels, len(sel.MatchExpressions) == 0 } diff --git a/vendor/kmodules.xyz/client-go/meta/preconditions.go b/vendor/kmodules.xyz/client-go/meta/preconditions.go index 5dddddb48..cf7d673d5 100644 --- a/vendor/kmodules.xyz/client-go/meta/preconditions.go +++ b/vendor/kmodules.xyz/client-go/meta/preconditions.go @@ -37,7 +37,8 @@ func (s PreConditionSet) PreconditionFunc() []mergepatch.PreconditionFunc { } for _, field := range sets.List[string](s.Set) { - preconditions = append(preconditions, + preconditions = append( + preconditions, RequireChainKeyUnchanged(field), ) } diff --git a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_helpers.go b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_helpers.go index e61c6d92d..d8203ff69 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_helpers.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_helpers.go @@ -36,6 +36,28 @@ import ( "sigs.k8s.io/controller-runtime/pkg/client" ) +// TenantOrgID returns the org this usage is billed to, falling back to the +// deprecated namespace org id until every producer sets Tenant. +func (s GenericResourceSpec) TenantOrgID() string { + if s.Tenant != nil && s.Tenant.OrgID != "" { + return s.Tenant.OrgID + } + if s.Namespace != nil { + return s.Namespace.AceOrgID + } + return "" +} + +func (s GenericResourceSpec) TenantOrgMetadata() map[string]string { + if s.Tenant != nil && s.Tenant.OrgID != "" { + return s.Tenant.Metadata + } + if s.Namespace != nil { + return s.Namespace.AceOrgMetadata + } + return nil +} + func GetGenericResourceName(item client.Object) string { return fmt.Sprintf("%s~%s", item.GetName(), item.GetObjectKind().GroupVersionKind().GroupKind()) } diff --git a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_types.go b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_types.go index 69ea8aa8a..13f091f20 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_types.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/generic_resource_types.go @@ -80,6 +80,7 @@ type GenericResourceSpec struct { RoleResourceRequests map[api.PodRole]ResourceList `json:"roleResourceRequests,omitempty"` Namespace *NamespaceInfo `json:"namespace,omitempty"` + Tenant *TenantInfo `json:"tenant,omitempty"` Pods []ComputeResource `json:"pods,omitempty"` Storage []StorageResource `json:"storage,omitempty"` @@ -91,12 +92,31 @@ type NamespaceInfo struct { UID types.UID `json:"uid,omitempty"` Name string `json:"name"` // +optional - CreationTimestamp metav1.Time `json:"creationTimestamp,omitempty"` - AceOrgID string `json:"aceOrgID,omitempty"` + CreationTimestamp metav1.Time `json:"creationTimestamp,omitempty"` + // Deprecated: use GenericResourceSpec.Tenant. Removed after one release. + AceOrgID string `json:"aceOrgID,omitempty"` + // Deprecated: use GenericResourceSpec.Tenant. Removed after one release. AceOrgMetadata map[string]string `json:"aceOrgMetadata,omitempty"` EnableResourceTrial bool `json:"enableResourceTrial,omitempty"` } +// +kubebuilder:validation:Enum=namespace;cluster +type TenantSource string + +const ( + TenantSourceNamespace TenantSource = "namespace" + TenantSourceCluster TenantSource = "cluster" +) + +// TenantInfo identifies the org a usage event is billed to, independent of how +// that org was discovered. +type TenantInfo struct { + OrgID string `json:"orgID,omitempty"` + // +optional + Metadata map[string]string `json:"metadata,omitempty"` + Source TenantSource `json:"source,omitempty"` +} + type ComputeResource struct { // +optional UID types.UID `json:"uid,omitempty"` diff --git a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/openapi_generated.go index b4558e12f..6fe628351 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -403,6 +401,7 @@ func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenA "kmodules.xyz/resource-metadata/apis/core/v1alpha1.ResourceView": schema_resource_metadata_apis_core_v1alpha1_ResourceView(ref), "kmodules.xyz/resource-metadata/apis/core/v1alpha1.Service": schema_resource_metadata_apis_core_v1alpha1_Service(ref), "kmodules.xyz/resource-metadata/apis/core/v1alpha1.StorageResource": schema_resource_metadata_apis_core_v1alpha1_StorageResource(ref), + "kmodules.xyz/resource-metadata/apis/core/v1alpha1.TenantInfo": schema_resource_metadata_apis_core_v1alpha1_TenantInfo(ref), "kmodules.xyz/resource-metadata/apis/shared.Action": schema_kmodulesxyz_resource_metadata_apis_shared_Action(ref), "kmodules.xyz/resource-metadata/apis/shared.ActionGroup": schema_kmodulesxyz_resource_metadata_apis_shared_ActionGroup(ref), "kmodules.xyz/resource-metadata/apis/shared.ActionInfo": schema_kmodulesxyz_resource_metadata_apis_shared_ActionInfo(ref), @@ -2311,6 +2310,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2353,6 +2353,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7278,6 +7279,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7375,6 +7377,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7448,6 +7451,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7899,6 +7903,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8415,6 +8420,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9657,7 +9663,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11272,6 +11278,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12786,10 +12793,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12827,6 +12834,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19246,10 +19254,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -20648,6 +20656,11 @@ func schema_resource_metadata_apis_core_v1alpha1_GenericResourceSpec(ref common. Ref: ref("kmodules.xyz/resource-metadata/apis/core/v1alpha1.NamespaceInfo"), }, }, + "tenant": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/core/v1alpha1.TenantInfo"), + }, + }, "pods": { SchemaProps: spec.SchemaProps{ Type: []string{"array"}, @@ -20685,7 +20698,7 @@ func schema_resource_metadata_apis_core_v1alpha1_GenericResourceSpec(ref common. }, }, Dependencies: []string{ - "kmodules.xyz/client-go/api/v1.ClusterMetadata", "kmodules.xyz/client-go/api/v1.ResourceID", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.ComputeResource", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.GenericResourceStatus", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.NamespaceInfo", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.ResourceRequirements", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.StorageResource"}, + "kmodules.xyz/client-go/api/v1.ClusterMetadata", "kmodules.xyz/client-go/api/v1.ResourceID", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.ComputeResource", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.GenericResourceStatus", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.NamespaceInfo", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.ResourceRequirements", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.StorageResource", "kmodules.xyz/resource-metadata/apis/core/v1alpha1.TenantInfo"}, } } @@ -20778,13 +20791,15 @@ func schema_resource_metadata_apis_core_v1alpha1_NamespaceInfo(ref common.Refere }, "aceOrgID": { SchemaProps: spec.SchemaProps{ - Type: []string{"string"}, - Format: "", + Description: "Deprecated: use GenericResourceSpec.Tenant. Removed after one release.", + Type: []string{"string"}, + Format: "", }, }, "aceOrgMetadata": { SchemaProps: spec.SchemaProps{ - Type: []string{"object"}, + Description: "Deprecated: use GenericResourceSpec.Tenant. Removed after one release.", + Type: []string{"object"}, AdditionalProperties: &spec.SchemaOrBool{ Allows: true, Schema: &spec.Schema{ @@ -21446,6 +21461,46 @@ func schema_resource_metadata_apis_core_v1alpha1_StorageResource(ref common.Refe } } +func schema_resource_metadata_apis_core_v1alpha1_TenantInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TenantInfo identifies the org a usage event is billed to, independent of how that org was discovered.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "orgID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "source": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + func schema_kmodulesxyz_resource_metadata_apis_shared_Action(ref common.ReferenceCallback) common.OpenAPIDefinition { return common.OpenAPIDefinition{ Schema: spec.Schema{ diff --git a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/zz_generated.deepcopy.go b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/zz_generated.deepcopy.go index a6b4e4a9c..152e7d64b 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/zz_generated.deepcopy.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/core/v1alpha1/zz_generated.deepcopy.go @@ -506,6 +506,11 @@ func (in *GenericResourceSpec) DeepCopyInto(out *GenericResourceSpec) { *out = new(NamespaceInfo) (*in).DeepCopyInto(*out) } + if in.Tenant != nil { + in, out := &in.Tenant, &out.Tenant + *out = new(TenantInfo) + (*in).DeepCopyInto(*out) + } if in.Pods != nil { in, out := &in.Pods, &out.Pods *out = make([]ComputeResource, len(*in)) @@ -1010,3 +1015,26 @@ func (in *StorageResource) DeepCopy() *StorageResource { in.DeepCopyInto(out) return out } + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TenantInfo) DeepCopyInto(out *TenantInfo) { + *out = *in + if in.Metadata != nil { + in, out := &in.Metadata, &out.Metadata + *out = make(map[string]string, len(*in)) + for key, val := range *in { + (*out)[key] = val + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TenantInfo. +func (in *TenantInfo) DeepCopy() *TenantInfo { + if in == nil { + return nil + } + out := new(TenantInfo) + in.DeepCopyInto(out) + return out +} diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/doc.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/doc.go new file mode 100644 index 000000000..9e1a5624a --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/doc.go @@ -0,0 +1,21 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package editor + +const ( + GroupName = "editor.ui.k8s.appscode.com" +) diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/doc.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/doc.go new file mode 100644 index 000000000..e9c9e07f3 --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/doc.go @@ -0,0 +1,23 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Package v1alpha1 is the v1alpha1 version of the API. + +// +k8s:deepcopy-gen=package,register +// +k8s:openapi-gen=true +// +k8s:defaulter-gen=TypeMeta +// +groupName=editor.ui.k8s.appscode.com +package v1alpha1 diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/editormodel_types.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/editormodel_types.go new file mode 100644 index 000000000..8412e35d8 --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/editormodel_types.go @@ -0,0 +1,82 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package v1alpha1 + +import ( + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + "k8s.io/apimachinery/pkg/runtime" + releasesapi "x-helm.dev/apimachinery/apis/releases/v1alpha1" +) + +const ( + ResourceKindEditorModel = "EditorModel" + ResourceEditorModel = "editormodel" + ResourceEditorModels = "editormodels" +) + +// EditorModel loads the editor model, manifest and resources for an existing +// installation identified by its metadata. It is the aggregated-API equivalent +// of kubepack.dev/lib-app/pkg/editor.LoadResourceEditorModel (see +// chart_template.go loadEditorModel2). +// +// +genclient +// +genclient:nonNamespaced +// +genclient:onlyVerbs=create +// +k8s:openapi-gen=true +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +// +kubebuilder:object:root=true +// +kubebuilder:resource:scope=Cluster +type EditorModel struct { + metav1.TypeMeta `json:",inline"` + // Request identifies the installation to load. + // +optional + Request *EditorModelRequest `json:"request,omitempty"` + // Response holds the loaded editor template. + // +optional + Response *EditorModelResponse `json:"response,omitempty"` +} + +type EditorModelRequest struct { + releasesapi.ModelMetadata `json:",inline"` + // Values is the editor chart's values, fetched by the caller. The chart is + // pulled (getChart) by the caller because it can take longer than the + // aggregated apiserver request budget; kube-ui-server only does the fast + // in-cluster reconstruction from these values. + // +optional + Values *runtime.RawExtension `json:"values,omitempty"` +} + +type EditorModelResponse struct { + // Manifest is the rendered manifest of the existing installation. + // +optional + Manifest string `json:"manifest,omitempty"` + // Values is the editor model (values) of the existing installation. + // +optional + Values *runtime.RawExtension `json:"values,omitempty"` + // Resources holds the individual resources of the existing installation. + // +optional + Resources []EditorModelResource `json:"resources,omitempty"` +} + +type EditorModelResource struct { + // +optional + Filename string `json:"filename,omitempty"` + // +optional + Key string `json:"key,omitempty"` + // +optional + Data *runtime.RawExtension `json:"data,omitempty"` +} diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/openapi_generated.go new file mode 100644 index 000000000..f932bd35a --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/openapi_generated.go @@ -0,0 +1,20782 @@ +//go:build !ignore_autogenerated +// +build !ignore_autogenerated + +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Code generated by openapi-gen. DO NOT EDIT. + +package v1alpha1 + +import ( + apiv1 "kmodules.xyz/client-go/api/v1" + + v1 "k8s.io/api/core/v1" + resource "k8s.io/apimachinery/pkg/api/resource" + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + intstr "k8s.io/apimachinery/pkg/util/intstr" + common "k8s.io/kube-openapi/pkg/common" + spec "k8s.io/kube-openapi/pkg/validation/spec" +) + +func GetOpenAPIDefinitions(ref common.ReferenceCallback) map[string]common.OpenAPIDefinition { + return map[string]common.OpenAPIDefinition{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource": schema_k8sio_api_core_v1_AWSElasticBlockStoreVolumeSource(ref), + "k8s.io/api/core/v1.Affinity": schema_k8sio_api_core_v1_Affinity(ref), + "k8s.io/api/core/v1.AppArmorProfile": schema_k8sio_api_core_v1_AppArmorProfile(ref), + "k8s.io/api/core/v1.AttachedVolume": schema_k8sio_api_core_v1_AttachedVolume(ref), + "k8s.io/api/core/v1.AvoidPods": schema_k8sio_api_core_v1_AvoidPods(ref), + "k8s.io/api/core/v1.AzureDiskVolumeSource": schema_k8sio_api_core_v1_AzureDiskVolumeSource(ref), + "k8s.io/api/core/v1.AzureFilePersistentVolumeSource": schema_k8sio_api_core_v1_AzureFilePersistentVolumeSource(ref), + "k8s.io/api/core/v1.AzureFileVolumeSource": schema_k8sio_api_core_v1_AzureFileVolumeSource(ref), + "k8s.io/api/core/v1.Binding": schema_k8sio_api_core_v1_Binding(ref), + "k8s.io/api/core/v1.CSIPersistentVolumeSource": schema_k8sio_api_core_v1_CSIPersistentVolumeSource(ref), + "k8s.io/api/core/v1.CSIVolumeSource": schema_k8sio_api_core_v1_CSIVolumeSource(ref), + "k8s.io/api/core/v1.Capabilities": schema_k8sio_api_core_v1_Capabilities(ref), + "k8s.io/api/core/v1.CephFSPersistentVolumeSource": schema_k8sio_api_core_v1_CephFSPersistentVolumeSource(ref), + "k8s.io/api/core/v1.CephFSVolumeSource": schema_k8sio_api_core_v1_CephFSVolumeSource(ref), + "k8s.io/api/core/v1.CinderPersistentVolumeSource": schema_k8sio_api_core_v1_CinderPersistentVolumeSource(ref), + "k8s.io/api/core/v1.CinderVolumeSource": schema_k8sio_api_core_v1_CinderVolumeSource(ref), + "k8s.io/api/core/v1.ClientIPConfig": schema_k8sio_api_core_v1_ClientIPConfig(ref), + "k8s.io/api/core/v1.ClusterTrustBundleProjection": schema_k8sio_api_core_v1_ClusterTrustBundleProjection(ref), + "k8s.io/api/core/v1.ComponentCondition": schema_k8sio_api_core_v1_ComponentCondition(ref), + "k8s.io/api/core/v1.ComponentStatus": schema_k8sio_api_core_v1_ComponentStatus(ref), + "k8s.io/api/core/v1.ComponentStatusList": schema_k8sio_api_core_v1_ComponentStatusList(ref), + "k8s.io/api/core/v1.ConfigMap": schema_k8sio_api_core_v1_ConfigMap(ref), + "k8s.io/api/core/v1.ConfigMapEnvSource": schema_k8sio_api_core_v1_ConfigMapEnvSource(ref), + "k8s.io/api/core/v1.ConfigMapKeySelector": schema_k8sio_api_core_v1_ConfigMapKeySelector(ref), + "k8s.io/api/core/v1.ConfigMapList": schema_k8sio_api_core_v1_ConfigMapList(ref), + "k8s.io/api/core/v1.ConfigMapNodeConfigSource": schema_k8sio_api_core_v1_ConfigMapNodeConfigSource(ref), + "k8s.io/api/core/v1.ConfigMapProjection": schema_k8sio_api_core_v1_ConfigMapProjection(ref), + "k8s.io/api/core/v1.ConfigMapVolumeSource": schema_k8sio_api_core_v1_ConfigMapVolumeSource(ref), + "k8s.io/api/core/v1.Container": schema_k8sio_api_core_v1_Container(ref), + "k8s.io/api/core/v1.ContainerExtendedResourceRequest": schema_k8sio_api_core_v1_ContainerExtendedResourceRequest(ref), + "k8s.io/api/core/v1.ContainerImage": schema_k8sio_api_core_v1_ContainerImage(ref), + "k8s.io/api/core/v1.ContainerPort": schema_k8sio_api_core_v1_ContainerPort(ref), + "k8s.io/api/core/v1.ContainerResizePolicy": schema_k8sio_api_core_v1_ContainerResizePolicy(ref), + "k8s.io/api/core/v1.ContainerRestartRule": schema_k8sio_api_core_v1_ContainerRestartRule(ref), + "k8s.io/api/core/v1.ContainerRestartRuleOnExitCodes": schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref), + "k8s.io/api/core/v1.ContainerState": schema_k8sio_api_core_v1_ContainerState(ref), + "k8s.io/api/core/v1.ContainerStateRunning": schema_k8sio_api_core_v1_ContainerStateRunning(ref), + "k8s.io/api/core/v1.ContainerStateTerminated": schema_k8sio_api_core_v1_ContainerStateTerminated(ref), + "k8s.io/api/core/v1.ContainerStateWaiting": schema_k8sio_api_core_v1_ContainerStateWaiting(ref), + "k8s.io/api/core/v1.ContainerStatus": schema_k8sio_api_core_v1_ContainerStatus(ref), + "k8s.io/api/core/v1.ContainerUser": schema_k8sio_api_core_v1_ContainerUser(ref), + "k8s.io/api/core/v1.DaemonEndpoint": schema_k8sio_api_core_v1_DaemonEndpoint(ref), + "k8s.io/api/core/v1.DownwardAPIProjection": schema_k8sio_api_core_v1_DownwardAPIProjection(ref), + "k8s.io/api/core/v1.DownwardAPIVolumeFile": schema_k8sio_api_core_v1_DownwardAPIVolumeFile(ref), + "k8s.io/api/core/v1.DownwardAPIVolumeSource": schema_k8sio_api_core_v1_DownwardAPIVolumeSource(ref), + "k8s.io/api/core/v1.EmptyDirVolumeSource": schema_k8sio_api_core_v1_EmptyDirVolumeSource(ref), + "k8s.io/api/core/v1.EndpointAddress": schema_k8sio_api_core_v1_EndpointAddress(ref), + "k8s.io/api/core/v1.EndpointPort": schema_k8sio_api_core_v1_EndpointPort(ref), + "k8s.io/api/core/v1.EndpointSubset": schema_k8sio_api_core_v1_EndpointSubset(ref), + "k8s.io/api/core/v1.Endpoints": schema_k8sio_api_core_v1_Endpoints(ref), + "k8s.io/api/core/v1.EndpointsList": schema_k8sio_api_core_v1_EndpointsList(ref), + "k8s.io/api/core/v1.EnvFromSource": schema_k8sio_api_core_v1_EnvFromSource(ref), + "k8s.io/api/core/v1.EnvVar": schema_k8sio_api_core_v1_EnvVar(ref), + "k8s.io/api/core/v1.EnvVarSource": schema_k8sio_api_core_v1_EnvVarSource(ref), + "k8s.io/api/core/v1.EphemeralContainer": schema_k8sio_api_core_v1_EphemeralContainer(ref), + "k8s.io/api/core/v1.EphemeralContainerCommon": schema_k8sio_api_core_v1_EphemeralContainerCommon(ref), + "k8s.io/api/core/v1.EphemeralVolumeSource": schema_k8sio_api_core_v1_EphemeralVolumeSource(ref), + "k8s.io/api/core/v1.Event": schema_k8sio_api_core_v1_Event(ref), + "k8s.io/api/core/v1.EventList": schema_k8sio_api_core_v1_EventList(ref), + "k8s.io/api/core/v1.EventSeries": schema_k8sio_api_core_v1_EventSeries(ref), + "k8s.io/api/core/v1.EventSource": schema_k8sio_api_core_v1_EventSource(ref), + "k8s.io/api/core/v1.ExecAction": schema_k8sio_api_core_v1_ExecAction(ref), + "k8s.io/api/core/v1.FCVolumeSource": schema_k8sio_api_core_v1_FCVolumeSource(ref), + "k8s.io/api/core/v1.FileKeySelector": schema_k8sio_api_core_v1_FileKeySelector(ref), + "k8s.io/api/core/v1.FlexPersistentVolumeSource": schema_k8sio_api_core_v1_FlexPersistentVolumeSource(ref), + "k8s.io/api/core/v1.FlexVolumeSource": schema_k8sio_api_core_v1_FlexVolumeSource(ref), + "k8s.io/api/core/v1.FlockerVolumeSource": schema_k8sio_api_core_v1_FlockerVolumeSource(ref), + "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource": schema_k8sio_api_core_v1_GCEPersistentDiskVolumeSource(ref), + "k8s.io/api/core/v1.GRPCAction": schema_k8sio_api_core_v1_GRPCAction(ref), + "k8s.io/api/core/v1.GitRepoVolumeSource": schema_k8sio_api_core_v1_GitRepoVolumeSource(ref), + "k8s.io/api/core/v1.GlusterfsPersistentVolumeSource": schema_k8sio_api_core_v1_GlusterfsPersistentVolumeSource(ref), + "k8s.io/api/core/v1.GlusterfsVolumeSource": schema_k8sio_api_core_v1_GlusterfsVolumeSource(ref), + "k8s.io/api/core/v1.HTTPGetAction": schema_k8sio_api_core_v1_HTTPGetAction(ref), + "k8s.io/api/core/v1.HTTPHeader": schema_k8sio_api_core_v1_HTTPHeader(ref), + "k8s.io/api/core/v1.HostAlias": schema_k8sio_api_core_v1_HostAlias(ref), + "k8s.io/api/core/v1.HostIP": schema_k8sio_api_core_v1_HostIP(ref), + "k8s.io/api/core/v1.HostPathVolumeSource": schema_k8sio_api_core_v1_HostPathVolumeSource(ref), + "k8s.io/api/core/v1.ISCSIPersistentVolumeSource": schema_k8sio_api_core_v1_ISCSIPersistentVolumeSource(ref), + "k8s.io/api/core/v1.ISCSIVolumeSource": schema_k8sio_api_core_v1_ISCSIVolumeSource(ref), + "k8s.io/api/core/v1.ImageVolumeSource": schema_k8sio_api_core_v1_ImageVolumeSource(ref), + "k8s.io/api/core/v1.KeyToPath": schema_k8sio_api_core_v1_KeyToPath(ref), + "k8s.io/api/core/v1.Lifecycle": schema_k8sio_api_core_v1_Lifecycle(ref), + "k8s.io/api/core/v1.LifecycleHandler": schema_k8sio_api_core_v1_LifecycleHandler(ref), + "k8s.io/api/core/v1.LimitRange": schema_k8sio_api_core_v1_LimitRange(ref), + "k8s.io/api/core/v1.LimitRangeItem": schema_k8sio_api_core_v1_LimitRangeItem(ref), + "k8s.io/api/core/v1.LimitRangeList": schema_k8sio_api_core_v1_LimitRangeList(ref), + "k8s.io/api/core/v1.LimitRangeSpec": schema_k8sio_api_core_v1_LimitRangeSpec(ref), + "k8s.io/api/core/v1.LinuxContainerUser": schema_k8sio_api_core_v1_LinuxContainerUser(ref), + "k8s.io/api/core/v1.List": schema_k8sio_api_core_v1_List(ref), + "k8s.io/api/core/v1.LoadBalancerIngress": schema_k8sio_api_core_v1_LoadBalancerIngress(ref), + "k8s.io/api/core/v1.LoadBalancerStatus": schema_k8sio_api_core_v1_LoadBalancerStatus(ref), + "k8s.io/api/core/v1.LocalObjectReference": schema_k8sio_api_core_v1_LocalObjectReference(ref), + "k8s.io/api/core/v1.LocalVolumeSource": schema_k8sio_api_core_v1_LocalVolumeSource(ref), + "k8s.io/api/core/v1.ModifyVolumeStatus": schema_k8sio_api_core_v1_ModifyVolumeStatus(ref), + "k8s.io/api/core/v1.NFSVolumeSource": schema_k8sio_api_core_v1_NFSVolumeSource(ref), + "k8s.io/api/core/v1.Namespace": schema_k8sio_api_core_v1_Namespace(ref), + "k8s.io/api/core/v1.NamespaceCondition": schema_k8sio_api_core_v1_NamespaceCondition(ref), + "k8s.io/api/core/v1.NamespaceList": schema_k8sio_api_core_v1_NamespaceList(ref), + "k8s.io/api/core/v1.NamespaceSpec": schema_k8sio_api_core_v1_NamespaceSpec(ref), + "k8s.io/api/core/v1.NamespaceStatus": schema_k8sio_api_core_v1_NamespaceStatus(ref), + "k8s.io/api/core/v1.Node": schema_k8sio_api_core_v1_Node(ref), + "k8s.io/api/core/v1.NodeAddress": schema_k8sio_api_core_v1_NodeAddress(ref), + "k8s.io/api/core/v1.NodeAffinity": schema_k8sio_api_core_v1_NodeAffinity(ref), + "k8s.io/api/core/v1.NodeCondition": schema_k8sio_api_core_v1_NodeCondition(ref), + "k8s.io/api/core/v1.NodeConfigSource": schema_k8sio_api_core_v1_NodeConfigSource(ref), + "k8s.io/api/core/v1.NodeConfigStatus": schema_k8sio_api_core_v1_NodeConfigStatus(ref), + "k8s.io/api/core/v1.NodeDaemonEndpoints": schema_k8sio_api_core_v1_NodeDaemonEndpoints(ref), + "k8s.io/api/core/v1.NodeFeatures": schema_k8sio_api_core_v1_NodeFeatures(ref), + "k8s.io/api/core/v1.NodeList": schema_k8sio_api_core_v1_NodeList(ref), + "k8s.io/api/core/v1.NodeProxyOptions": schema_k8sio_api_core_v1_NodeProxyOptions(ref), + "k8s.io/api/core/v1.NodeRuntimeHandler": schema_k8sio_api_core_v1_NodeRuntimeHandler(ref), + "k8s.io/api/core/v1.NodeRuntimeHandlerFeatures": schema_k8sio_api_core_v1_NodeRuntimeHandlerFeatures(ref), + "k8s.io/api/core/v1.NodeSelector": schema_k8sio_api_core_v1_NodeSelector(ref), + "k8s.io/api/core/v1.NodeSelectorRequirement": schema_k8sio_api_core_v1_NodeSelectorRequirement(ref), + "k8s.io/api/core/v1.NodeSelectorTerm": schema_k8sio_api_core_v1_NodeSelectorTerm(ref), + "k8s.io/api/core/v1.NodeSpec": schema_k8sio_api_core_v1_NodeSpec(ref), + "k8s.io/api/core/v1.NodeStatus": schema_k8sio_api_core_v1_NodeStatus(ref), + "k8s.io/api/core/v1.NodeSwapStatus": schema_k8sio_api_core_v1_NodeSwapStatus(ref), + "k8s.io/api/core/v1.NodeSystemInfo": schema_k8sio_api_core_v1_NodeSystemInfo(ref), + "k8s.io/api/core/v1.ObjectFieldSelector": schema_k8sio_api_core_v1_ObjectFieldSelector(ref), + "k8s.io/api/core/v1.ObjectReference": schema_k8sio_api_core_v1_ObjectReference(ref), + "k8s.io/api/core/v1.PersistentVolume": schema_k8sio_api_core_v1_PersistentVolume(ref), + "k8s.io/api/core/v1.PersistentVolumeClaim": schema_k8sio_api_core_v1_PersistentVolumeClaim(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimCondition": schema_k8sio_api_core_v1_PersistentVolumeClaimCondition(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimList": schema_k8sio_api_core_v1_PersistentVolumeClaimList(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimSpec": schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimStatus": schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimTemplate": schema_k8sio_api_core_v1_PersistentVolumeClaimTemplate(ref), + "k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource": schema_k8sio_api_core_v1_PersistentVolumeClaimVolumeSource(ref), + "k8s.io/api/core/v1.PersistentVolumeList": schema_k8sio_api_core_v1_PersistentVolumeList(ref), + "k8s.io/api/core/v1.PersistentVolumeSource": schema_k8sio_api_core_v1_PersistentVolumeSource(ref), + "k8s.io/api/core/v1.PersistentVolumeSpec": schema_k8sio_api_core_v1_PersistentVolumeSpec(ref), + "k8s.io/api/core/v1.PersistentVolumeStatus": schema_k8sio_api_core_v1_PersistentVolumeStatus(ref), + "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource": schema_k8sio_api_core_v1_PhotonPersistentDiskVolumeSource(ref), + "k8s.io/api/core/v1.Pod": schema_k8sio_api_core_v1_Pod(ref), + "k8s.io/api/core/v1.PodAffinity": schema_k8sio_api_core_v1_PodAffinity(ref), + "k8s.io/api/core/v1.PodAffinityTerm": schema_k8sio_api_core_v1_PodAffinityTerm(ref), + "k8s.io/api/core/v1.PodAntiAffinity": schema_k8sio_api_core_v1_PodAntiAffinity(ref), + "k8s.io/api/core/v1.PodAttachOptions": schema_k8sio_api_core_v1_PodAttachOptions(ref), + "k8s.io/api/core/v1.PodCertificateProjection": schema_k8sio_api_core_v1_PodCertificateProjection(ref), + "k8s.io/api/core/v1.PodCondition": schema_k8sio_api_core_v1_PodCondition(ref), + "k8s.io/api/core/v1.PodDNSConfig": schema_k8sio_api_core_v1_PodDNSConfig(ref), + "k8s.io/api/core/v1.PodDNSConfigOption": schema_k8sio_api_core_v1_PodDNSConfigOption(ref), + "k8s.io/api/core/v1.PodExecOptions": schema_k8sio_api_core_v1_PodExecOptions(ref), + "k8s.io/api/core/v1.PodExtendedResourceClaimStatus": schema_k8sio_api_core_v1_PodExtendedResourceClaimStatus(ref), + "k8s.io/api/core/v1.PodIP": schema_k8sio_api_core_v1_PodIP(ref), + "k8s.io/api/core/v1.PodList": schema_k8sio_api_core_v1_PodList(ref), + "k8s.io/api/core/v1.PodLogOptions": schema_k8sio_api_core_v1_PodLogOptions(ref), + "k8s.io/api/core/v1.PodOS": schema_k8sio_api_core_v1_PodOS(ref), + "k8s.io/api/core/v1.PodPortForwardOptions": schema_k8sio_api_core_v1_PodPortForwardOptions(ref), + "k8s.io/api/core/v1.PodProxyOptions": schema_k8sio_api_core_v1_PodProxyOptions(ref), + "k8s.io/api/core/v1.PodReadinessGate": schema_k8sio_api_core_v1_PodReadinessGate(ref), + "k8s.io/api/core/v1.PodResourceClaim": schema_k8sio_api_core_v1_PodResourceClaim(ref), + "k8s.io/api/core/v1.PodResourceClaimStatus": schema_k8sio_api_core_v1_PodResourceClaimStatus(ref), + "k8s.io/api/core/v1.PodSchedulingGate": schema_k8sio_api_core_v1_PodSchedulingGate(ref), + "k8s.io/api/core/v1.PodSecurityContext": schema_k8sio_api_core_v1_PodSecurityContext(ref), + "k8s.io/api/core/v1.PodSignature": schema_k8sio_api_core_v1_PodSignature(ref), + "k8s.io/api/core/v1.PodSpec": schema_k8sio_api_core_v1_PodSpec(ref), + "k8s.io/api/core/v1.PodStatus": schema_k8sio_api_core_v1_PodStatus(ref), + "k8s.io/api/core/v1.PodStatusResult": schema_k8sio_api_core_v1_PodStatusResult(ref), + "k8s.io/api/core/v1.PodTemplate": schema_k8sio_api_core_v1_PodTemplate(ref), + "k8s.io/api/core/v1.PodTemplateList": schema_k8sio_api_core_v1_PodTemplateList(ref), + "k8s.io/api/core/v1.PodTemplateSpec": schema_k8sio_api_core_v1_PodTemplateSpec(ref), + "k8s.io/api/core/v1.PortStatus": schema_k8sio_api_core_v1_PortStatus(ref), + "k8s.io/api/core/v1.PortworxVolumeSource": schema_k8sio_api_core_v1_PortworxVolumeSource(ref), + "k8s.io/api/core/v1.PreferAvoidPodsEntry": schema_k8sio_api_core_v1_PreferAvoidPodsEntry(ref), + "k8s.io/api/core/v1.PreferredSchedulingTerm": schema_k8sio_api_core_v1_PreferredSchedulingTerm(ref), + "k8s.io/api/core/v1.Probe": schema_k8sio_api_core_v1_Probe(ref), + "k8s.io/api/core/v1.ProbeHandler": schema_k8sio_api_core_v1_ProbeHandler(ref), + "k8s.io/api/core/v1.ProjectedVolumeSource": schema_k8sio_api_core_v1_ProjectedVolumeSource(ref), + "k8s.io/api/core/v1.QuobyteVolumeSource": schema_k8sio_api_core_v1_QuobyteVolumeSource(ref), + "k8s.io/api/core/v1.RBDPersistentVolumeSource": schema_k8sio_api_core_v1_RBDPersistentVolumeSource(ref), + "k8s.io/api/core/v1.RBDVolumeSource": schema_k8sio_api_core_v1_RBDVolumeSource(ref), + "k8s.io/api/core/v1.RangeAllocation": schema_k8sio_api_core_v1_RangeAllocation(ref), + "k8s.io/api/core/v1.ReplicationController": schema_k8sio_api_core_v1_ReplicationController(ref), + "k8s.io/api/core/v1.ReplicationControllerCondition": schema_k8sio_api_core_v1_ReplicationControllerCondition(ref), + "k8s.io/api/core/v1.ReplicationControllerList": schema_k8sio_api_core_v1_ReplicationControllerList(ref), + "k8s.io/api/core/v1.ReplicationControllerSpec": schema_k8sio_api_core_v1_ReplicationControllerSpec(ref), + "k8s.io/api/core/v1.ReplicationControllerStatus": schema_k8sio_api_core_v1_ReplicationControllerStatus(ref), + "k8s.io/api/core/v1.ResourceClaim": schema_k8sio_api_core_v1_ResourceClaim(ref), + "k8s.io/api/core/v1.ResourceFieldSelector": schema_k8sio_api_core_v1_ResourceFieldSelector(ref), + "k8s.io/api/core/v1.ResourceHealth": schema_k8sio_api_core_v1_ResourceHealth(ref), + "k8s.io/api/core/v1.ResourceQuota": schema_k8sio_api_core_v1_ResourceQuota(ref), + "k8s.io/api/core/v1.ResourceQuotaList": schema_k8sio_api_core_v1_ResourceQuotaList(ref), + "k8s.io/api/core/v1.ResourceQuotaSpec": schema_k8sio_api_core_v1_ResourceQuotaSpec(ref), + "k8s.io/api/core/v1.ResourceQuotaStatus": schema_k8sio_api_core_v1_ResourceQuotaStatus(ref), + "k8s.io/api/core/v1.ResourceRequirements": schema_k8sio_api_core_v1_ResourceRequirements(ref), + "k8s.io/api/core/v1.ResourceStatus": schema_k8sio_api_core_v1_ResourceStatus(ref), + "k8s.io/api/core/v1.SELinuxOptions": schema_k8sio_api_core_v1_SELinuxOptions(ref), + "k8s.io/api/core/v1.ScaleIOPersistentVolumeSource": schema_k8sio_api_core_v1_ScaleIOPersistentVolumeSource(ref), + "k8s.io/api/core/v1.ScaleIOVolumeSource": schema_k8sio_api_core_v1_ScaleIOVolumeSource(ref), + "k8s.io/api/core/v1.ScopeSelector": schema_k8sio_api_core_v1_ScopeSelector(ref), + "k8s.io/api/core/v1.ScopedResourceSelectorRequirement": schema_k8sio_api_core_v1_ScopedResourceSelectorRequirement(ref), + "k8s.io/api/core/v1.SeccompProfile": schema_k8sio_api_core_v1_SeccompProfile(ref), + "k8s.io/api/core/v1.Secret": schema_k8sio_api_core_v1_Secret(ref), + "k8s.io/api/core/v1.SecretEnvSource": schema_k8sio_api_core_v1_SecretEnvSource(ref), + "k8s.io/api/core/v1.SecretKeySelector": schema_k8sio_api_core_v1_SecretKeySelector(ref), + "k8s.io/api/core/v1.SecretList": schema_k8sio_api_core_v1_SecretList(ref), + "k8s.io/api/core/v1.SecretProjection": schema_k8sio_api_core_v1_SecretProjection(ref), + "k8s.io/api/core/v1.SecretReference": schema_k8sio_api_core_v1_SecretReference(ref), + "k8s.io/api/core/v1.SecretVolumeSource": schema_k8sio_api_core_v1_SecretVolumeSource(ref), + "k8s.io/api/core/v1.SecurityContext": schema_k8sio_api_core_v1_SecurityContext(ref), + "k8s.io/api/core/v1.SerializedReference": schema_k8sio_api_core_v1_SerializedReference(ref), + "k8s.io/api/core/v1.Service": schema_k8sio_api_core_v1_Service(ref), + "k8s.io/api/core/v1.ServiceAccount": schema_k8sio_api_core_v1_ServiceAccount(ref), + "k8s.io/api/core/v1.ServiceAccountList": schema_k8sio_api_core_v1_ServiceAccountList(ref), + "k8s.io/api/core/v1.ServiceAccountTokenProjection": schema_k8sio_api_core_v1_ServiceAccountTokenProjection(ref), + "k8s.io/api/core/v1.ServiceList": schema_k8sio_api_core_v1_ServiceList(ref), + "k8s.io/api/core/v1.ServicePort": schema_k8sio_api_core_v1_ServicePort(ref), + "k8s.io/api/core/v1.ServiceProxyOptions": schema_k8sio_api_core_v1_ServiceProxyOptions(ref), + "k8s.io/api/core/v1.ServiceSpec": schema_k8sio_api_core_v1_ServiceSpec(ref), + "k8s.io/api/core/v1.ServiceStatus": schema_k8sio_api_core_v1_ServiceStatus(ref), + "k8s.io/api/core/v1.SessionAffinityConfig": schema_k8sio_api_core_v1_SessionAffinityConfig(ref), + "k8s.io/api/core/v1.SleepAction": schema_k8sio_api_core_v1_SleepAction(ref), + "k8s.io/api/core/v1.StorageOSPersistentVolumeSource": schema_k8sio_api_core_v1_StorageOSPersistentVolumeSource(ref), + "k8s.io/api/core/v1.StorageOSVolumeSource": schema_k8sio_api_core_v1_StorageOSVolumeSource(ref), + "k8s.io/api/core/v1.Sysctl": schema_k8sio_api_core_v1_Sysctl(ref), + "k8s.io/api/core/v1.TCPSocketAction": schema_k8sio_api_core_v1_TCPSocketAction(ref), + "k8s.io/api/core/v1.Taint": schema_k8sio_api_core_v1_Taint(ref), + "k8s.io/api/core/v1.Toleration": schema_k8sio_api_core_v1_Toleration(ref), + "k8s.io/api/core/v1.TopologySelectorLabelRequirement": schema_k8sio_api_core_v1_TopologySelectorLabelRequirement(ref), + "k8s.io/api/core/v1.TopologySelectorTerm": schema_k8sio_api_core_v1_TopologySelectorTerm(ref), + "k8s.io/api/core/v1.TopologySpreadConstraint": schema_k8sio_api_core_v1_TopologySpreadConstraint(ref), + "k8s.io/api/core/v1.TypedLocalObjectReference": schema_k8sio_api_core_v1_TypedLocalObjectReference(ref), + "k8s.io/api/core/v1.TypedObjectReference": schema_k8sio_api_core_v1_TypedObjectReference(ref), + "k8s.io/api/core/v1.Volume": schema_k8sio_api_core_v1_Volume(ref), + "k8s.io/api/core/v1.VolumeDevice": schema_k8sio_api_core_v1_VolumeDevice(ref), + "k8s.io/api/core/v1.VolumeMount": schema_k8sio_api_core_v1_VolumeMount(ref), + "k8s.io/api/core/v1.VolumeMountStatus": schema_k8sio_api_core_v1_VolumeMountStatus(ref), + "k8s.io/api/core/v1.VolumeNodeAffinity": schema_k8sio_api_core_v1_VolumeNodeAffinity(ref), + "k8s.io/api/core/v1.VolumeProjection": schema_k8sio_api_core_v1_VolumeProjection(ref), + "k8s.io/api/core/v1.VolumeResourceRequirements": schema_k8sio_api_core_v1_VolumeResourceRequirements(ref), + "k8s.io/api/core/v1.VolumeSource": schema_k8sio_api_core_v1_VolumeSource(ref), + "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource": schema_k8sio_api_core_v1_VsphereVirtualDiskVolumeSource(ref), + "k8s.io/api/core/v1.WeightedPodAffinityTerm": schema_k8sio_api_core_v1_WeightedPodAffinityTerm(ref), + "k8s.io/api/core/v1.WindowsSecurityContextOptions": schema_k8sio_api_core_v1_WindowsSecurityContextOptions(ref), + "k8s.io/apimachinery/pkg/api/resource.Quantity": schema_apimachinery_pkg_api_resource_Quantity(ref), + "k8s.io/apimachinery/pkg/api/resource.int64Amount": schema_apimachinery_pkg_api_resource_int64Amount(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.APIGroup": schema_pkg_apis_meta_v1_APIGroup(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.APIGroupList": schema_pkg_apis_meta_v1_APIGroupList(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.APIResource": schema_pkg_apis_meta_v1_APIResource(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.APIResourceList": schema_pkg_apis_meta_v1_APIResourceList(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.APIVersions": schema_pkg_apis_meta_v1_APIVersions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ApplyOptions": schema_pkg_apis_meta_v1_ApplyOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Condition": schema_pkg_apis_meta_v1_Condition(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.CreateOptions": schema_pkg_apis_meta_v1_CreateOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.DeleteOptions": schema_pkg_apis_meta_v1_DeleteOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Duration": schema_pkg_apis_meta_v1_Duration(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.FieldSelectorRequirement": schema_pkg_apis_meta_v1_FieldSelectorRequirement(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.FieldsV1": schema_pkg_apis_meta_v1_FieldsV1(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GetOptions": schema_pkg_apis_meta_v1_GetOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupKind": schema_pkg_apis_meta_v1_GroupKind(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupResource": schema_pkg_apis_meta_v1_GroupResource(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersion": schema_pkg_apis_meta_v1_GroupVersion(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionForDiscovery": schema_pkg_apis_meta_v1_GroupVersionForDiscovery(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionKind": schema_pkg_apis_meta_v1_GroupVersionKind(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionResource": schema_pkg_apis_meta_v1_GroupVersionResource(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.InternalEvent": schema_pkg_apis_meta_v1_InternalEvent(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector": schema_pkg_apis_meta_v1_LabelSelector(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelectorRequirement": schema_pkg_apis_meta_v1_LabelSelectorRequirement(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.List": schema_pkg_apis_meta_v1_List(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta": schema_pkg_apis_meta_v1_ListMeta(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ListOptions": schema_pkg_apis_meta_v1_ListOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ManagedFieldsEntry": schema_pkg_apis_meta_v1_ManagedFieldsEntry(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.MicroTime": schema_pkg_apis_meta_v1_MicroTime(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta": schema_pkg_apis_meta_v1_ObjectMeta(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference": schema_pkg_apis_meta_v1_OwnerReference(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.PartialObjectMetadata": schema_pkg_apis_meta_v1_PartialObjectMetadata(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.PartialObjectMetadataList": schema_pkg_apis_meta_v1_PartialObjectMetadataList(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Patch": schema_pkg_apis_meta_v1_Patch(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.PatchOptions": schema_pkg_apis_meta_v1_PatchOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Preconditions": schema_pkg_apis_meta_v1_Preconditions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.RootPaths": schema_pkg_apis_meta_v1_RootPaths(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.ServerAddressByClientCIDR": schema_pkg_apis_meta_v1_ServerAddressByClientCIDR(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Status": schema_pkg_apis_meta_v1_Status(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.StatusCause": schema_pkg_apis_meta_v1_StatusCause(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.StatusDetails": schema_pkg_apis_meta_v1_StatusDetails(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Table": schema_pkg_apis_meta_v1_Table(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.TableColumnDefinition": schema_pkg_apis_meta_v1_TableColumnDefinition(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.TableOptions": schema_pkg_apis_meta_v1_TableOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.TableRow": schema_pkg_apis_meta_v1_TableRow(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.TableRowCondition": schema_pkg_apis_meta_v1_TableRowCondition(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Time": schema_pkg_apis_meta_v1_Time(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.Timestamp": schema_pkg_apis_meta_v1_Timestamp(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.TypeMeta": schema_pkg_apis_meta_v1_TypeMeta(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.UpdateOptions": schema_pkg_apis_meta_v1_UpdateOptions(ref), + "k8s.io/apimachinery/pkg/apis/meta/v1.WatchEvent": schema_pkg_apis_meta_v1_WatchEvent(ref), + "k8s.io/apimachinery/pkg/runtime.RawExtension": schema_k8sio_apimachinery_pkg_runtime_RawExtension(ref), + "k8s.io/apimachinery/pkg/runtime.TypeMeta": schema_k8sio_apimachinery_pkg_runtime_TypeMeta(ref), + "k8s.io/apimachinery/pkg/runtime.Unknown": schema_k8sio_apimachinery_pkg_runtime_Unknown(ref), + "k8s.io/apimachinery/pkg/util/intstr.IntOrString": schema_apimachinery_pkg_util_intstr_IntOrString(ref), + "k8s.io/apimachinery/pkg/version.Info": schema_k8sio_apimachinery_pkg_version_Info(ref), + "kmodules.xyz/client-go/api/v1.CAPIClusterInfo": schema_kmodulesxyz_client_go_api_v1_CAPIClusterInfo(ref), + "kmodules.xyz/client-go/api/v1.CertificatePrivateKey": schema_kmodulesxyz_client_go_api_v1_CertificatePrivateKey(ref), + "kmodules.xyz/client-go/api/v1.CertificateSpec": schema_kmodulesxyz_client_go_api_v1_CertificateSpec(ref), + "kmodules.xyz/client-go/api/v1.ClusterClaimFeatures": schema_kmodulesxyz_client_go_api_v1_ClusterClaimFeatures(ref), + "kmodules.xyz/client-go/api/v1.ClusterClaimInfo": schema_kmodulesxyz_client_go_api_v1_ClusterClaimInfo(ref), + "kmodules.xyz/client-go/api/v1.ClusterInfo": schema_kmodulesxyz_client_go_api_v1_ClusterInfo(ref), + "kmodules.xyz/client-go/api/v1.ClusterMetadata": schema_kmodulesxyz_client_go_api_v1_ClusterMetadata(ref), + "kmodules.xyz/client-go/api/v1.Condition": schema_kmodulesxyz_client_go_api_v1_Condition(ref), + "kmodules.xyz/client-go/api/v1.HealthCheckSpec": schema_kmodulesxyz_client_go_api_v1_HealthCheckSpec(ref), + "kmodules.xyz/client-go/api/v1.ImageInfo": schema_kmodulesxyz_client_go_api_v1_ImageInfo(ref), + "kmodules.xyz/client-go/api/v1.Lineage": schema_kmodulesxyz_client_go_api_v1_Lineage(ref), + "kmodules.xyz/client-go/api/v1.ObjectID": schema_kmodulesxyz_client_go_api_v1_ObjectID(ref), + "kmodules.xyz/client-go/api/v1.ObjectInfo": schema_kmodulesxyz_client_go_api_v1_ObjectInfo(ref), + "kmodules.xyz/client-go/api/v1.ObjectReference": schema_kmodulesxyz_client_go_api_v1_ObjectReference(ref), + "kmodules.xyz/client-go/api/v1.PullCredentials": schema_kmodulesxyz_client_go_api_v1_PullCredentials(ref), + "kmodules.xyz/client-go/api/v1.ReadonlyHealthCheckSpec": schema_kmodulesxyz_client_go_api_v1_ReadonlyHealthCheckSpec(ref), + "kmodules.xyz/client-go/api/v1.ResourceID": schema_kmodulesxyz_client_go_api_v1_ResourceID(ref), + "kmodules.xyz/client-go/api/v1.TLSConfig": schema_kmodulesxyz_client_go_api_v1_TLSConfig(ref), + "kmodules.xyz/client-go/api/v1.TimeOfDay": schema_kmodulesxyz_client_go_api_v1_TimeOfDay(ref), + "kmodules.xyz/client-go/api/v1.TypeReference": schema_kmodulesxyz_client_go_api_v1_TypeReference(ref), + "kmodules.xyz/client-go/api/v1.TypedObjectReference": schema_kmodulesxyz_client_go_api_v1_TypedObjectReference(ref), + "kmodules.xyz/client-go/api/v1.X509Subject": schema_kmodulesxyz_client_go_api_v1_X509Subject(ref), + "kmodules.xyz/client-go/api/v1.stringSetMerger": schema_kmodulesxyz_client_go_api_v1_stringSetMerger(ref), + "kmodules.xyz/offshoot-api/api/v1.ContainerRuntimeSettings": schema_kmodulesxyz_offshoot_api_api_v1_ContainerRuntimeSettings(ref), + "kmodules.xyz/offshoot-api/api/v1.EphemeralVolumeSource": schema_kmodulesxyz_offshoot_api_api_v1_EphemeralVolumeSource(ref), + "kmodules.xyz/offshoot-api/api/v1.Gateway": schema_kmodulesxyz_offshoot_api_api_v1_Gateway(ref), + "kmodules.xyz/offshoot-api/api/v1.GatewayPort": schema_kmodulesxyz_offshoot_api_api_v1_GatewayPort(ref), + "kmodules.xyz/offshoot-api/api/v1.IONiceSettings": schema_kmodulesxyz_offshoot_api_api_v1_IONiceSettings(ref), + "kmodules.xyz/offshoot-api/api/v1.NamedServiceStatus": schema_kmodulesxyz_offshoot_api_api_v1_NamedServiceStatus(ref), + "kmodules.xyz/offshoot-api/api/v1.NamedURL": schema_kmodulesxyz_offshoot_api_api_v1_NamedURL(ref), + "kmodules.xyz/offshoot-api/api/v1.NiceSettings": schema_kmodulesxyz_offshoot_api_api_v1_NiceSettings(ref), + "kmodules.xyz/offshoot-api/api/v1.ObjectMeta": schema_kmodulesxyz_offshoot_api_api_v1_ObjectMeta(ref), + "kmodules.xyz/offshoot-api/api/v1.PartialObjectMeta": schema_kmodulesxyz_offshoot_api_api_v1_PartialObjectMeta(ref), + "kmodules.xyz/offshoot-api/api/v1.PersistentVolumeClaim": schema_kmodulesxyz_offshoot_api_api_v1_PersistentVolumeClaim(ref), + "kmodules.xyz/offshoot-api/api/v1.PersistentVolumeClaimTemplate": schema_kmodulesxyz_offshoot_api_api_v1_PersistentVolumeClaimTemplate(ref), + "kmodules.xyz/offshoot-api/api/v1.PodRuntimeSettings": schema_kmodulesxyz_offshoot_api_api_v1_PodRuntimeSettings(ref), + "kmodules.xyz/offshoot-api/api/v1.PodSpec": schema_kmodulesxyz_offshoot_api_api_v1_PodSpec(ref), + "kmodules.xyz/offshoot-api/api/v1.PodTemplateSpec": schema_kmodulesxyz_offshoot_api_api_v1_PodTemplateSpec(ref), + "kmodules.xyz/offshoot-api/api/v1.RuntimeSettings": schema_kmodulesxyz_offshoot_api_api_v1_RuntimeSettings(ref), + "kmodules.xyz/offshoot-api/api/v1.ServicePort": schema_kmodulesxyz_offshoot_api_api_v1_ServicePort(ref), + "kmodules.xyz/offshoot-api/api/v1.ServiceSpec": schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref), + "kmodules.xyz/offshoot-api/api/v1.ServiceTemplateSpec": schema_kmodulesxyz_offshoot_api_api_v1_ServiceTemplateSpec(ref), + "kmodules.xyz/offshoot-api/api/v1.Volume": schema_kmodulesxyz_offshoot_api_api_v1_Volume(ref), + "kmodules.xyz/offshoot-api/api/v1.VolumeSource": schema_kmodulesxyz_offshoot_api_api_v1_VolumeSource(ref), + "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModel": schema_resource_metadata_apis_editor_v1alpha1_EditorModel(ref), + "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelRequest": schema_resource_metadata_apis_editor_v1alpha1_EditorModelRequest(ref), + "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResource": schema_resource_metadata_apis_editor_v1alpha1_EditorModelResource(ref), + "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResponse": schema_resource_metadata_apis_editor_v1alpha1_EditorModelResponse(ref), + "kmodules.xyz/resource-metadata/apis/shared.Action": schema_kmodulesxyz_resource_metadata_apis_shared_Action(ref), + "kmodules.xyz/resource-metadata/apis/shared.ActionGroup": schema_kmodulesxyz_resource_metadata_apis_shared_ActionGroup(ref), + "kmodules.xyz/resource-metadata/apis/shared.ActionInfo": schema_kmodulesxyz_resource_metadata_apis_shared_ActionInfo(ref), + "kmodules.xyz/resource-metadata/apis/shared.ActionTemplate": schema_kmodulesxyz_resource_metadata_apis_shared_ActionTemplate(ref), + "kmodules.xyz/resource-metadata/apis/shared.ActionTemplateGroup": schema_kmodulesxyz_resource_metadata_apis_shared_ActionTemplateGroup(ref), + "kmodules.xyz/resource-metadata/apis/shared.BootstrapPresets": schema_kmodulesxyz_resource_metadata_apis_shared_BootstrapPresets(ref), + "kmodules.xyz/resource-metadata/apis/shared.Dashboard": schema_kmodulesxyz_resource_metadata_apis_shared_Dashboard(ref), + "kmodules.xyz/resource-metadata/apis/shared.DashboardVar": schema_kmodulesxyz_resource_metadata_apis_shared_DashboardVar(ref), + "kmodules.xyz/resource-metadata/apis/shared.DeploymentParameters": schema_kmodulesxyz_resource_metadata_apis_shared_DeploymentParameters(ref), + "kmodules.xyz/resource-metadata/apis/shared.DistroSpec": schema_kmodulesxyz_resource_metadata_apis_shared_DistroSpec(ref), + "kmodules.xyz/resource-metadata/apis/shared.HelmInfo": schema_kmodulesxyz_resource_metadata_apis_shared_HelmInfo(ref), + "kmodules.xyz/resource-metadata/apis/shared.HelmRelease": schema_kmodulesxyz_resource_metadata_apis_shared_HelmRelease(ref), + "kmodules.xyz/resource-metadata/apis/shared.HelmRepository": schema_kmodulesxyz_resource_metadata_apis_shared_HelmRepository(ref), + "kmodules.xyz/resource-metadata/apis/shared.If": schema_kmodulesxyz_resource_metadata_apis_shared_If(ref), + "kmodules.xyz/resource-metadata/apis/shared.ImageRegistrySpec": schema_kmodulesxyz_resource_metadata_apis_shared_ImageRegistrySpec(ref), + "kmodules.xyz/resource-metadata/apis/shared.RegistryInfo": schema_kmodulesxyz_resource_metadata_apis_shared_RegistryInfo(ref), + "kmodules.xyz/resource-metadata/apis/shared.RegistryProxies": schema_kmodulesxyz_resource_metadata_apis_shared_RegistryProxies(ref), + "kmodules.xyz/resource-metadata/apis/shared.ResourceLocator": schema_kmodulesxyz_resource_metadata_apis_shared_ResourceLocator(ref), + "kmodules.xyz/resource-metadata/apis/shared.ResourceQuery": schema_kmodulesxyz_resource_metadata_apis_shared_ResourceQuery(ref), + "kmodules.xyz/resource-metadata/apis/shared.SourceLocator": schema_kmodulesxyz_resource_metadata_apis_shared_SourceLocator(ref), + "kmodules.xyz/resource-metadata/apis/shared.UIParameterTemplate": schema_kmodulesxyz_resource_metadata_apis_shared_UIParameterTemplate(ref), + "kmodules.xyz/resource-metadata/apis/shared.UIParameters": schema_kmodulesxyz_resource_metadata_apis_shared_UIParameters(ref), + } +} + +func schema_k8sio_api_core_v1_AWSElasticBlockStoreVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Persistent Disk resource in AWS.\n\nAn AWS EBS disk must exist before mounting to a container. The disk must also be in the same AWS zone as the kubelet. An AWS EBS disk can only be mounted as read/write once. AWS EBS volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeID": { + SchemaProps: spec.SchemaProps{ + Description: "volumeID is unique ID of the persistent disk resource in AWS (Amazon EBS volume). More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Type: []string{"string"}, + Format: "", + }, + }, + "partition": { + SchemaProps: spec.SchemaProps{ + Description: "partition is the partition in the volume that you want to mount. If omitted, the default is to mount by volume name. Examples: For volume /dev/sda1, you specify the partition as \"1\". Similarly, the volume partition for /dev/sda is \"0\" (or you can leave the property empty).", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly value true will force the readOnly setting in VolumeMounts. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"volumeID"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Affinity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Affinity is a group of affinity scheduling rules.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "nodeAffinity": { + SchemaProps: spec.SchemaProps{ + Description: "Describes node affinity scheduling rules for the pod.", + Ref: ref("k8s.io/api/core/v1.NodeAffinity"), + }, + }, + "podAffinity": { + SchemaProps: spec.SchemaProps{ + Description: "Describes pod affinity scheduling rules (e.g. co-locate this pod in the same node, zone, etc. as some other pod(s)).", + Ref: ref("k8s.io/api/core/v1.PodAffinity"), + }, + }, + "podAntiAffinity": { + SchemaProps: spec.SchemaProps{ + Description: "Describes pod anti-affinity scheduling rules (e.g. avoid putting this pod in the same node, zone, etc. as some other pod(s)).", + Ref: ref("k8s.io/api/core/v1.PodAntiAffinity"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeAffinity", "k8s.io/api/core/v1.PodAffinity", "k8s.io/api/core/v1.PodAntiAffinity"}, + } +} + +func schema_k8sio_api_core_v1_AppArmorProfile(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AppArmorProfile defines a pod or container's AppArmor settings.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type indicates which kind of AppArmor profile will be applied. Valid options are:\n Localhost - a profile pre-loaded on the node.\n RuntimeDefault - the container runtime's default profile.\n Unconfined - no AppArmor enforcement.\n\nPossible enum values:\n - `\"Localhost\"` indicates that a profile pre-loaded on the node should be used.\n - `\"RuntimeDefault\"` indicates that the container runtime's default AppArmor profile should be used.\n - `\"Unconfined\"` indicates that no AppArmor profile should be enforced.", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Localhost", "RuntimeDefault", "Unconfined"}, + }, + }, + "localhostProfile": { + SchemaProps: spec.SchemaProps{ + Description: "localhostProfile indicates a profile loaded on the node that should be used. The profile must be preconfigured on the node to work. Must match the loaded name of the profile. Must be set if and only if type is \"Localhost\".", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-unions": []interface{}{ + map[string]interface{}{ + "discriminator": "type", + "fields-to-discriminateBy": map[string]interface{}{ + "localhostProfile": "LocalhostProfile", + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_AttachedVolume(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AttachedVolume describes a volume attached to a node", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the attached volume", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "devicePath": { + SchemaProps: spec.SchemaProps{ + Description: "DevicePath represents the device path where the volume should be available", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "devicePath"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_AvoidPods(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AvoidPods describes pods that should avoid this node. This is the value for a Node annotation with key scheduler.alpha.kubernetes.io/preferAvoidPods and will eventually become a field of NodeStatus.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "preferAvoidPods": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Bounded-sized list of signatures of pods that should avoid this node, sorted in timestamp order from oldest to newest. Size of the slice is unspecified.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PreferAvoidPodsEntry"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PreferAvoidPodsEntry"}, + } +} + +func schema_k8sio_api_core_v1_AzureDiskVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AzureDisk represents an Azure Data Disk mount on the host and bind mount to the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "diskName": { + SchemaProps: spec.SchemaProps{ + Description: "diskName is the Name of the data disk in the blob storage", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "diskURI": { + SchemaProps: spec.SchemaProps{ + Description: "diskURI is the URI of data disk in the blob storage", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "cachingMode": { + SchemaProps: spec.SchemaProps{ + Description: "cachingMode is the Host Caching mode: None, Read Only, Read Write.\n\nPossible enum values:\n - `\"None\"`\n - `\"ReadOnly\"`\n - `\"ReadWrite\"`", + Default: v1.AzureDataDiskCachingReadWrite, + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"None", "ReadOnly", "ReadWrite"}, + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is Filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Default: "ext4", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "kind expected values are Shared: multiple blob disks per storage account Dedicated: single blob disk per storage account Managed: azure managed data disk (only in managed availability set). defaults to shared\n\nPossible enum values:\n - `\"Dedicated\"`\n - `\"Managed\"`\n - `\"Shared\"`", + Default: v1.AzureSharedBlobDisk, + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Dedicated", "Managed", "Shared"}, + }, + }, + }, + Required: []string{"diskName", "diskURI"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_AzureFilePersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AzureFile represents an Azure File Service mount on the host and bind mount to the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "secretName": { + SchemaProps: spec.SchemaProps{ + Description: "secretName is the name of secret that contains Azure Storage Account Name and Key", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "shareName": { + SchemaProps: spec.SchemaProps{ + Description: "shareName is the azure Share Name", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "secretNamespace is the namespace of the secret that contains Azure Storage Account Name and Key default is the same as the Pod", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"secretName", "shareName"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_AzureFileVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "AzureFile represents an Azure File Service mount on the host and bind mount to the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "secretName": { + SchemaProps: spec.SchemaProps{ + Description: "secretName is the name of secret that contains Azure Storage Account Name and Key", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "shareName": { + SchemaProps: spec.SchemaProps{ + Description: "shareName is the azure share Name", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"secretName", "shareName"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Binding(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Binding ties one object to another; for example, a pod is bound to a node by a scheduler.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "target": { + SchemaProps: spec.SchemaProps{ + Description: "The target object that you want to bind to the standard object.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + }, + Required: []string{"target"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_CSIPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents storage that is managed by an external CSI volume driver", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "driver": { + SchemaProps: spec.SchemaProps{ + Description: "driver is the name of the driver to use for this volume. Required.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeHandle": { + SchemaProps: spec.SchemaProps{ + Description: "volumeHandle is the unique volume name returned by the CSI volume plugin’s CreateVolume to refer to the volume on all subsequent calls. Required.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly value to pass to ControllerPublishVolumeRequest. Defaults to false (read/write).", + Type: []string{"boolean"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\".", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeAttributes": { + SchemaProps: spec.SchemaProps{ + Description: "volumeAttributes of the volume to publish.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "controllerPublishSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "controllerPublishSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI ControllerPublishVolume and ControllerUnpublishVolume calls. This field is optional, and may be empty if no secret is required. If the secret object contains more than one secret, all secrets are passed.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "nodeStageSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "nodeStageSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI NodeStageVolume and NodeStageVolume and NodeUnstageVolume calls. This field is optional, and may be empty if no secret is required. If the secret object contains more than one secret, all secrets are passed.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "nodePublishSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "nodePublishSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI NodePublishVolume and NodeUnpublishVolume calls. This field is optional, and may be empty if no secret is required. If the secret object contains more than one secret, all secrets are passed.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "controllerExpandSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "controllerExpandSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI ControllerExpandVolume call. This field is optional, and may be empty if no secret is required. If the secret object contains more than one secret, all secrets are passed.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "nodeExpandSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "nodeExpandSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI NodeExpandVolume call. This field is optional, may be omitted if no secret is required. If the secret object contains more than one secret, all secrets are passed.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + }, + Required: []string{"driver", "volumeHandle"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_CSIVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a source location of a volume to mount, managed by an external CSI driver", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "driver": { + SchemaProps: spec.SchemaProps{ + Description: "driver is the name of the CSI driver that handles this volume. Consult with your admin for the correct name as registered in the cluster.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly specifies a read-only configuration for the volume. Defaults to false (read/write).", + Type: []string{"boolean"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType to mount. Ex. \"ext4\", \"xfs\", \"ntfs\". If not provided, the empty value is passed to the associated CSI driver which will determine the default filesystem to apply.", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeAttributes": { + SchemaProps: spec.SchemaProps{ + Description: "volumeAttributes stores driver-specific properties that are passed to the CSI driver. Consult your driver's documentation for supported values.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "nodePublishSecretRef": { + SchemaProps: spec.SchemaProps{ + Description: "nodePublishSecretRef is a reference to the secret object containing sensitive information to pass to the CSI driver to complete the CSI NodePublishVolume and NodeUnpublishVolume calls. This field is optional, and may be empty if no secret is required. If the secret object contains more than one secret, all secret references are passed.", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + Required: []string{"driver"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_Capabilities(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Adds and removes POSIX capabilities from running containers.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "add": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Added capabilities", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "drop": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Removed capabilities", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_CephFSPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Ceph Filesystem mount that lasts the lifetime of a pod Cephfs volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "monitors": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "monitors is Required: Monitors is a collection of Ceph monitors More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is Optional: Used as the mounted root, rather than the full Ceph tree, default is /", + Type: []string{"string"}, + Format: "", + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "user is Optional: User is the rados user name, default is admin More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"string"}, + Format: "", + }, + }, + "secretFile": { + SchemaProps: spec.SchemaProps{ + Description: "secretFile is Optional: SecretFile is the path to key ring for User, default is /etc/ceph/user.secret More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is Optional: SecretRef is reference to the authentication secret for User, default is empty. More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts. More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"monitors"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_CephFSVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Ceph Filesystem mount that lasts the lifetime of a pod Cephfs volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "monitors": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "monitors is Required: Monitors is a collection of Ceph monitors More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is Optional: Used as the mounted root, rather than the full Ceph tree, default is /", + Type: []string{"string"}, + Format: "", + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "user is optional: User is the rados user name, default is admin More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"string"}, + Format: "", + }, + }, + "secretFile": { + SchemaProps: spec.SchemaProps{ + Description: "secretFile is Optional: SecretFile is the path to key ring for User, default is /etc/ceph/user.secret More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is Optional: SecretRef is reference to the authentication secret for User, default is empty. More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts. More info: https://examples.k8s.io/volumes/cephfs/README.md#how-to-use-it", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"monitors"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_CinderPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a cinder volume resource in Openstack. A Cinder volume must exist before mounting to a container. The volume must also be in the same region as the kubelet. Cinder volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeID": { + SchemaProps: spec.SchemaProps{ + Description: "volumeID used to identify the volume in cinder. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType Filesystem type to mount. Must be a filesystem type supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is Optional: points to a secret object containing parameters used to connect to OpenStack.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + }, + Required: []string{"volumeID"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_CinderVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a cinder volume resource in Openstack. A Cinder volume must exist before mounting to a container. The volume must also be in the same region as the kubelet. Cinder volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeID": { + SchemaProps: spec.SchemaProps{ + Description: "volumeID used to identify the volume in cinder. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is optional: points to a secret object containing parameters used to connect to OpenStack.", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + Required: []string{"volumeID"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_ClientIPConfig(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ClientIPConfig represents the configurations of Client IP based session affinity.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "timeoutSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "timeoutSeconds specifies the seconds of ClientIP type session sticky time. The value must be >0 && <=86400(for 1 day) if ServiceAffinity == \"ClientIP\". Default value is 10800(for 3 hours).", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ClusterTrustBundleProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ClusterTrustBundleProjection describes how to select a set of ClusterTrustBundle objects and project their contents into the pod filesystem.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Select a single ClusterTrustBundle by object name. Mutually-exclusive with signerName and labelSelector.", + Type: []string{"string"}, + Format: "", + }, + }, + "signerName": { + SchemaProps: spec.SchemaProps{ + Description: "Select all ClusterTrustBundles that match this signer name. Mutually-exclusive with name. The contents of all selected ClusterTrustBundles will be unified and deduplicated.", + Type: []string{"string"}, + Format: "", + }, + }, + "labelSelector": { + SchemaProps: spec.SchemaProps{ + Description: "Select all ClusterTrustBundles that match this label selector. Only has effect if signerName is set. Mutually-exclusive with name. If unset, interpreted as \"match nothing\". If set but empty, interpreted as \"match everything\".", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"), + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "If true, don't block pod startup if the referenced ClusterTrustBundle(s) aren't available. If using name, then the named ClusterTrustBundle is allowed not to exist. If using signerName, then the combination of signerName and labelSelector is allowed to match zero ClusterTrustBundles.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Relative path from the volume root to write the bundle.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"path"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"}, + } +} + +func schema_k8sio_api_core_v1_ComponentCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Information about the condition of a component.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of condition for a component. Valid value: \"Healthy\"", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition for a component. Valid values for \"Healthy\": \"True\", \"False\", or \"Unknown\".", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Message about the condition for a component. For example, information about a health check.", + Type: []string{"string"}, + Format: "", + }, + }, + "error": { + SchemaProps: spec.SchemaProps{ + Description: "Condition error code for a component. For example, a health check error code.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ComponentStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ComponentStatus (and ComponentStatusList) holds the cluster validation info. Deprecated: This API is deprecated in v1.19+", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of component conditions observed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ComponentCondition"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ComponentCondition", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ComponentStatusList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Status of all the conditions for the component as a list of ComponentStatus objects. Deprecated: This API is deprecated in v1.19+", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of ComponentStatus objects.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ComponentStatus"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ComponentStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ConfigMap(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ConfigMap holds configuration data for pods to consume.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "immutable": { + SchemaProps: spec.SchemaProps{ + Description: "Immutable, if set to true, ensures that data stored in the ConfigMap cannot be updated (only object metadata can be modified). If not set to true, the field can be modified at any time. Defaulted to nil.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "data": { + SchemaProps: spec.SchemaProps{ + Description: "Data contains the configuration data. Each key must consist of alphanumeric characters, '-', '_' or '.'. Values with non-UTF-8 byte sequences must use the BinaryData field. The keys stored in Data must not overlap with the keys in the BinaryData field, this is enforced during validation process.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "binaryData": { + SchemaProps: spec.SchemaProps{ + Description: "BinaryData contains the binary data. Each key must consist of alphanumeric characters, '-', '_' or '.'. BinaryData can contain byte sequences that are not in the UTF-8 range. The keys stored in BinaryData must not overlap with the ones in the Data field, this is enforced during validation process. Using this field will require 1.10+ apiserver and kubelet.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "byte", + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ConfigMapEnvSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ConfigMapEnvSource selects a ConfigMap to populate the environment variables with.\n\nThe contents of the target ConfigMap's Data field will represent the key-value pairs as environment variables.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "Specify whether the ConfigMap must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ConfigMapKeySelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Selects a key from a ConfigMap.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "key": { + SchemaProps: spec.SchemaProps{ + Description: "The key to select.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "Specify whether the ConfigMap or its key must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"key"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ConfigMapList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ConfigMapList is a resource containing a list of ConfigMap objects.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "Items is the list of ConfigMaps.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ConfigMap"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ConfigMap", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ConfigMapNodeConfigSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ConfigMapNodeConfigSource contains the information to reference a ConfigMap as a config source for the Node. This API is deprecated since 1.22: https://git.k8s.io/enhancements/keps/sig-node/281-dynamic-kubelet-configuration", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace is the metadata.namespace of the referenced ConfigMap. This field is required in all cases.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is the metadata.name of the referenced ConfigMap. This field is required in all cases.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID is the metadata.UID of the referenced ConfigMap. This field is forbidden in Node.Spec, and required in Node.Status.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceVersion is the metadata.ResourceVersion of the referenced ConfigMap. This field is forbidden in Node.Spec, and required in Node.Status.", + Type: []string{"string"}, + Format: "", + }, + }, + "kubeletConfigKey": { + SchemaProps: spec.SchemaProps{ + Description: "KubeletConfigKey declares which key of the referenced ConfigMap corresponds to the KubeletConfiguration structure This field is required in all cases.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"namespace", "name", "kubeletConfigKey"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ConfigMapProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Adapts a ConfigMap into a projected volume.\n\nThe contents of the target ConfigMap's Data field will be presented in a projected volume as files using the keys in the Data field as the file names, unless the items element is populated with specific mappings of keys to paths. Note that this is identical to a configmap volume source without the default mode.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "items if unspecified, each key-value pair in the Data field of the referenced ConfigMap will be projected into the volume as a file whose name is the key and content is the value. If specified, the listed keys will be projected into the specified paths, and unlisted keys will not be present. If a key is specified which is not present in the ConfigMap, the volume setup will error unless it is marked optional. Paths must be relative and may not contain the '..' path or start with '..'.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.KeyToPath"), + }, + }, + }, + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "optional specify whether the ConfigMap or its keys must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.KeyToPath"}, + } +} + +func schema_k8sio_api_core_v1_ConfigMapVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Adapts a ConfigMap into a volume.\n\nThe contents of the target ConfigMap's Data field will be presented in a volume as files using the keys in the Data field as the file names, unless the items element is populated with specific mappings of keys to paths. ConfigMap volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "items if unspecified, each key-value pair in the Data field of the referenced ConfigMap will be projected into the volume as a file whose name is the key and content is the value. If specified, the listed keys will be projected into the specified paths, and unlisted keys will not be present. If a key is specified which is not present in the ConfigMap, the volume setup will error unless it is marked optional. Paths must be relative and may not contain the '..' path or start with '..'.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.KeyToPath"), + }, + }, + }, + }, + }, + "defaultMode": { + SchemaProps: spec.SchemaProps{ + Description: "defaultMode is optional: mode bits used to set permissions on created files by default. Must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. Defaults to 0644. Directories within the path are not affected by this setting. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "optional specify whether the ConfigMap or its keys must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.KeyToPath"}, + } +} + +func schema_k8sio_api_core_v1_Container(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A single application container that you want to run within a pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the container specified as a DNS_LABEL. Each container in a pod must have a unique name (DNS_LABEL). Cannot be updated.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "Container image name. More info: https://kubernetes.io/docs/concepts/containers/images This field is optional to allow higher level config management to default or override container images in workload controllers like Deployments and StatefulSets.", + Type: []string{"string"}, + Format: "", + }, + }, + "command": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Entrypoint array. Not executed within a shell. The container image's ENTRYPOINT is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "args": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Arguments to the entrypoint. The container image's CMD is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "workingDir": { + SchemaProps: spec.SchemaProps{ + Description: "Container's working directory. If not specified, the container runtime's default will be used, which might be configured in the container image. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "containerPort", + "protocol", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "containerPort", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of ports to expose from the container. Not specifying a port here DOES NOT prevent that port from being exposed. Any port which is listening on the default \"0.0.0.0\" address inside a container will be accessible from the network. Modifying this array with strategic merge patch may corrupt the data. For more information See https://github.com/kubernetes/kubernetes/issues/108255. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerPort"), + }, + }, + }, + }, + }, + "envFrom": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of sources to populate environment variables in the container. The keys defined within a source may consist of any printable ASCII characters except '='. When a key exists in multiple sources, the value associated with the last source will take precedence. Values defined by an Env with a duplicate key will take precedence. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvFromSource"), + }, + }, + }, + }, + }, + "env": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of environment variables to set in the container. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvVar"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Compute Resources required by this container. Cannot be updated. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "resizePolicy": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Resources resize policy for the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerResizePolicy"), + }, + }, + }, + }, + }, + "restartPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "RestartPolicy defines the restart behavior of individual containers in a pod. This overrides the pod-level restart policy. When this field is not specified, the restart behavior is defined by the Pod's restart policy and the container type. Additionally, setting the RestartPolicy as \"Always\" for the init container will have the following effect: this init container will be continually restarted on exit until all regular containers have terminated. Once all regular containers have completed, all init containers with restartPolicy \"Always\" will be shut down. This lifecycle differs from normal init containers and is often referred to as a \"sidecar\" container. Although this init container still starts in the init container sequence, it does not wait for the container to complete before proceeding to the next init container. Instead, the next init container starts immediately after this init container is started, or after any startupProbe has successfully completed.", + Type: []string{"string"}, + Format: "", + }, + }, + "restartPolicyRules": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Represents a list of rules to be checked to determine if the container should be restarted on exit. The rules are evaluated in order. Once a rule matches a container exit condition, the remaining rules are ignored. If no rule matches the container exit condition, the Container-level restart policy determines the whether the container is restarted or not. Constraints on the rules: - At most 20 rules are allowed. - Rules can have the same action. - Identical rules are not forbidden in validations. When rules are specified, container MUST set RestartPolicy explicitly even it if matches the Pod's RestartPolicy.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerRestartRule"), + }, + }, + }, + }, + }, + "volumeMounts": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "mountPath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "mountPath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Pod volumes to mount into the container's filesystem. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeMount"), + }, + }, + }, + }, + }, + "volumeDevices": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "devicePath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "devicePath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "volumeDevices is the list of block devices to be used by the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeDevice"), + }, + }, + }, + }, + }, + "livenessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container liveness. Container will be restarted if the probe fails. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "readinessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container service readiness. Container will be removed from service endpoints if the probe fails. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "startupProbe": { + SchemaProps: spec.SchemaProps{ + Description: "StartupProbe indicates that the Pod has successfully initialized. If specified, no other probes are executed until this completes successfully. If this probe fails, the Pod will be restarted, just as if the livenessProbe failed. This can be used to provide different probe parameters at the beginning of a Pod's lifecycle, when it might take a long time to load data or warm a cache, than during steady-state operation. This cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "lifecycle": { + SchemaProps: spec.SchemaProps{ + Description: "Actions that the management system should take in response to container lifecycle events. Cannot be updated.", + Ref: ref("k8s.io/api/core/v1.Lifecycle"), + }, + }, + "terminationMessagePath": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: Path at which the file to which the container's termination message will be written is mounted into the container's filesystem. Message written is intended to be brief final status, such as an assertion failure message. Will be truncated by the node if greater than 4096 bytes. The total message length across all containers will be limited to 12kb. Defaults to /dev/termination-log. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "terminationMessagePolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Indicate how the termination message should be populated. File will use the contents of terminationMessagePath to populate the container status message on both success and failure. FallbackToLogsOnError will use the last chunk of container log output if the termination message file is empty and the container exited with an error. The log output is limited to 2048 bytes or 80 lines, whichever is smaller. Defaults to File. Cannot be updated.\n\nPossible enum values:\n - `\"FallbackToLogsOnError\"` will read the most recent contents of the container logs for the container status message when the container exits with an error and the terminationMessagePath has no contents.\n - `\"File\"` is the default behavior and will set the container status message to the contents of the container's terminationMessagePath when the container exits.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"FallbackToLogsOnError", "File"}, + }, + }, + "imagePullPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Image pull policy. One of Always, Never, IfNotPresent. Defaults to Always if :latest tag is specified, or IfNotPresent otherwise. Cannot be updated. More info: https://kubernetes.io/docs/concepts/containers/images#updating-images\n\nPossible enum values:\n - `\"Always\"` means that kubelet always attempts to pull the latest image. Container will fail If the pull fails.\n - `\"IfNotPresent\"` means that kubelet pulls if the image isn't present on disk. Container will fail if the image isn't present and the pull fails.\n - `\"Never\"` means that kubelet never pulls an image, but only uses a local image. Container will fail if the image isn't present", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "IfNotPresent", "Never"}, + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "SecurityContext defines the security options the container should be run with. If set, the fields of SecurityContext override the equivalent fields of PodSecurityContext. More info: https://kubernetes.io/docs/tasks/configure-pod-container/security-context/", + Ref: ref("k8s.io/api/core/v1.SecurityContext"), + }, + }, + "stdin": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a buffer for stdin in the container runtime. If this is not set, reads from stdin in the container will always result in EOF. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stdinOnce": { + SchemaProps: spec.SchemaProps{ + Description: "Whether the container runtime should close the stdin channel after it has been opened by a single attach. When stdin is true the stdin stream will remain open across multiple attach sessions. If stdinOnce is set to true, stdin is opened on container start, is empty until the first client attaches to stdin, and then remains open and accepts data until the client disconnects, at which time stdin is closed and remains closed until the container is restarted. If this flag is false, a container processes that reads from stdin will never receive an EOF. Default is false", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tty": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a TTY for itself, also requires 'stdin' to be true. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerPort", "k8s.io/api/core/v1.ContainerResizePolicy", "k8s.io/api/core/v1.ContainerRestartRule", "k8s.io/api/core/v1.EnvFromSource", "k8s.io/api/core/v1.EnvVar", "k8s.io/api/core/v1.Lifecycle", "k8s.io/api/core/v1.Probe", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.SecurityContext", "k8s.io/api/core/v1.VolumeDevice", "k8s.io/api/core/v1.VolumeMount"}, + } +} + +func schema_k8sio_api_core_v1_ContainerExtendedResourceRequest(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerExtendedResourceRequest has the mapping of container name, extended resource name to the device request name.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "containerName": { + SchemaProps: spec.SchemaProps{ + Description: "The name of the container requesting resources.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceName": { + SchemaProps: spec.SchemaProps{ + Description: "The name of the extended resource in that container which gets backed by DRA.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "requestName": { + SchemaProps: spec.SchemaProps{ + Description: "The name of the request in the special ResourceClaim which corresponds to the extended resource.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"containerName", "resourceName", "requestName"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerImage(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Describe a container image", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "names": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Names by which this image is known. e.g. [\"kubernetes.example/hyperkube:v1.0.7\", \"cloud-vendor.registry.example/cloud-vendor/hyperkube:v1.0.7\"]", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "sizeBytes": { + SchemaProps: spec.SchemaProps{ + Description: "The size of the image in bytes.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerPort(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerPort represents a network port in a single container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, this must be an IANA_SVC_NAME and unique within the pod. Each named port in a pod must have a unique name. Name for the port that can be referred to by services.", + Type: []string{"string"}, + Format: "", + }, + }, + "hostPort": { + SchemaProps: spec.SchemaProps{ + Description: "Number of port to expose on the host. If specified, this must be a valid port number, 0 < x < 65536. If HostNetwork is specified, this must match ContainerPort. Most containers do not need this.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "containerPort": { + SchemaProps: spec.SchemaProps{ + Description: "Number of port to expose on the pod's IP address. This must be a valid port number, 0 < x < 65536.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "protocol": { + SchemaProps: spec.SchemaProps{ + Description: "Protocol for port. Must be UDP, TCP, or SCTP. Defaults to \"TCP\".\n\nPossible enum values:\n - `\"SCTP\"` is the SCTP protocol.\n - `\"TCP\"` is the TCP protocol.\n - `\"UDP\"` is the UDP protocol.", + Default: "TCP", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SCTP", "TCP", "UDP"}, + }, + }, + "hostIP": { + SchemaProps: spec.SchemaProps{ + Description: "What host IP to bind the external port to.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"containerPort"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerResizePolicy(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerResizePolicy represents resource resize policy for the container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "resourceName": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the resource to which this resource resize policy applies. Supported values: cpu, memory.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "restartPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Restart policy to apply when specified resource is resized. If not specified, it defaults to NotRequired.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"resourceName", "restartPolicy"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerRestartRule describes how a container exit is handled.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "action": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the action taken on a container exit if the requirements are satisfied. The only possible value is \"Restart\" to restart the container.", + Type: []string{"string"}, + Format: "", + }, + }, + "exitCodes": { + SchemaProps: spec.SchemaProps{ + Description: "Represents the exit codes to check on container exits.", + Ref: ref("k8s.io/api/core/v1.ContainerRestartRuleOnExitCodes"), + }, + }, + }, + Required: []string{"action"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerRestartRuleOnExitCodes"}, + } +} + +func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerRestartRuleOnExitCodes describes the condition for handling an exited container based on its exit codes.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "Represents the relationship between the container exit code(s) and the specified values. Possible values are: - In: the requirement is satisfied if the container exit code is in the\n set of specified values.\n- NotIn: the requirement is satisfied if the container exit code is\n not in the set of specified values.", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "set", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Specifies the set of values to check for container exit codes. At most 255 elements are allowed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + }, + Required: []string{"operator"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerState(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerState holds a possible state of container. Only one of its members may be specified. If none of them is specified, the default one is ContainerStateWaiting.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "waiting": { + SchemaProps: spec.SchemaProps{ + Description: "Details about a waiting container", + Ref: ref("k8s.io/api/core/v1.ContainerStateWaiting"), + }, + }, + "running": { + SchemaProps: spec.SchemaProps{ + Description: "Details about a running container", + Ref: ref("k8s.io/api/core/v1.ContainerStateRunning"), + }, + }, + "terminated": { + SchemaProps: spec.SchemaProps{ + Description: "Details about a terminated container", + Ref: ref("k8s.io/api/core/v1.ContainerStateTerminated"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerStateRunning", "k8s.io/api/core/v1.ContainerStateTerminated", "k8s.io/api/core/v1.ContainerStateWaiting"}, + } +} + +func schema_k8sio_api_core_v1_ContainerStateRunning(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerStateRunning is a running state of a container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "startedAt": { + SchemaProps: spec.SchemaProps{ + Description: "Time at which the container was last (re-)started", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_ContainerStateTerminated(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerStateTerminated is a terminated state of a container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "exitCode": { + SchemaProps: spec.SchemaProps{ + Description: "Exit status from the last termination of the container", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "signal": { + SchemaProps: spec.SchemaProps{ + Description: "Signal from the last termination of the container", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "(brief) reason from the last termination of the container", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Message regarding the last termination of the container", + Type: []string{"string"}, + Format: "", + }, + }, + "startedAt": { + SchemaProps: spec.SchemaProps{ + Description: "Time at which previous execution of the container started", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "finishedAt": { + SchemaProps: spec.SchemaProps{ + Description: "Time at which the container last terminated", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "containerID": { + SchemaProps: spec.SchemaProps{ + Description: "Container's ID in the format '://'", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"exitCode"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_ContainerStateWaiting(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerStateWaiting is a waiting state of a container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "(brief) reason the container is not yet running.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Message regarding why the container is not yet running.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ContainerStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerStatus contains details for the current status of this container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is a DNS_LABEL representing the unique name of the container. Each container in a pod must have a unique name across all container types. Cannot be updated.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "state": { + SchemaProps: spec.SchemaProps{ + Description: "State holds details about the container's current condition.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerState"), + }, + }, + "lastState": { + SchemaProps: spec.SchemaProps{ + Description: "LastTerminationState holds the last termination state of the container to help debug container crashes and restarts. This field is not populated if the container is still running and RestartCount is 0.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerState"), + }, + }, + "ready": { + SchemaProps: spec.SchemaProps{ + Description: "Ready specifies whether the container is currently passing its readiness check. The value will change as readiness probes keep executing. If no readiness probes are specified, this field defaults to true once the container is fully started (see Started field).\n\nThe value is typically used to determine whether a container is ready to accept traffic.", + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "restartCount": { + SchemaProps: spec.SchemaProps{ + Description: "RestartCount holds the number of times the container has been restarted. Kubelet makes an effort to always increment the value, but there are cases when the state may be lost due to node restarts and then the value may be reset to 0. The value is never negative.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "Image is the name of container image that the container is running. The container image may not match the image used in the PodSpec, as it may have been resolved by the runtime. More info: https://kubernetes.io/docs/concepts/containers/images.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "imageID": { + SchemaProps: spec.SchemaProps{ + Description: "ImageID is the image ID of the container's image. The image ID may not match the image ID of the image used in the PodSpec, as it may have been resolved by the runtime.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "containerID": { + SchemaProps: spec.SchemaProps{ + Description: "ContainerID is the ID of the container in the format '://'. Where type is a container runtime identifier, returned from Version call of CRI API (for example \"containerd\").", + Type: []string{"string"}, + Format: "", + }, + }, + "started": { + SchemaProps: spec.SchemaProps{ + Description: "Started indicates whether the container has finished its postStart lifecycle hook and passed its startup probe. Initialized as false, becomes true after startupProbe is considered successful. Resets to false when the container is restarted, or if kubelet loses state temporarily. In both cases, startup probes will run again. Is always true when no startupProbe is defined and container is running and has passed the postStart lifecycle hook. The null value must be treated the same as false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "allocatedResources": { + SchemaProps: spec.SchemaProps{ + Description: "AllocatedResources represents the compute resources allocated for this container by the node. Kubelet sets this value to Container.Resources.Requests upon successful pod admission and after successfully admitting desired pod resize.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Resources represents the compute resource requests and limits that have been successfully enacted on the running container after it has been started or has been successfully resized.", + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "volumeMounts": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "mountPath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "mountPath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Status of volume mounts.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeMountStatus"), + }, + }, + }, + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "User represents user identity information initially attached to the first process of the container", + Ref: ref("k8s.io/api/core/v1.ContainerUser"), + }, + }, + "allocatedResourcesStatus": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "AllocatedResourcesStatus represents the status of various resources allocated for this Pod.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceStatus"), + }, + }, + }, + }, + }, + "stopSignal": { + SchemaProps: spec.SchemaProps{ + Description: "StopSignal reports the effective stop signal for this container\n\nPossible enum values:\n - `\"SIGABRT\"`\n - `\"SIGALRM\"`\n - `\"SIGBUS\"`\n - `\"SIGCHLD\"`\n - `\"SIGCLD\"`\n - `\"SIGCONT\"`\n - `\"SIGFPE\"`\n - `\"SIGHUP\"`\n - `\"SIGILL\"`\n - `\"SIGINT\"`\n - `\"SIGIO\"`\n - `\"SIGIOT\"`\n - `\"SIGKILL\"`\n - `\"SIGPIPE\"`\n - `\"SIGPOLL\"`\n - `\"SIGPROF\"`\n - `\"SIGPWR\"`\n - `\"SIGQUIT\"`\n - `\"SIGRTMAX\"`\n - `\"SIGRTMAX-1\"`\n - `\"SIGRTMAX-10\"`\n - `\"SIGRTMAX-11\"`\n - `\"SIGRTMAX-12\"`\n - `\"SIGRTMAX-13\"`\n - `\"SIGRTMAX-14\"`\n - `\"SIGRTMAX-2\"`\n - `\"SIGRTMAX-3\"`\n - `\"SIGRTMAX-4\"`\n - `\"SIGRTMAX-5\"`\n - `\"SIGRTMAX-6\"`\n - `\"SIGRTMAX-7\"`\n - `\"SIGRTMAX-8\"`\n - `\"SIGRTMAX-9\"`\n - `\"SIGRTMIN\"`\n - `\"SIGRTMIN+1\"`\n - `\"SIGRTMIN+10\"`\n - `\"SIGRTMIN+11\"`\n - `\"SIGRTMIN+12\"`\n - `\"SIGRTMIN+13\"`\n - `\"SIGRTMIN+14\"`\n - `\"SIGRTMIN+15\"`\n - `\"SIGRTMIN+2\"`\n - `\"SIGRTMIN+3\"`\n - `\"SIGRTMIN+4\"`\n - `\"SIGRTMIN+5\"`\n - `\"SIGRTMIN+6\"`\n - `\"SIGRTMIN+7\"`\n - `\"SIGRTMIN+8\"`\n - `\"SIGRTMIN+9\"`\n - `\"SIGSEGV\"`\n - `\"SIGSTKFLT\"`\n - `\"SIGSTOP\"`\n - `\"SIGSYS\"`\n - `\"SIGTERM\"`\n - `\"SIGTRAP\"`\n - `\"SIGTSTP\"`\n - `\"SIGTTIN\"`\n - `\"SIGTTOU\"`\n - `\"SIGURG\"`\n - `\"SIGUSR1\"`\n - `\"SIGUSR2\"`\n - `\"SIGVTALRM\"`\n - `\"SIGWINCH\"`\n - `\"SIGXCPU\"`\n - `\"SIGXFSZ\"`", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SIGABRT", "SIGALRM", "SIGBUS", "SIGCHLD", "SIGCLD", "SIGCONT", "SIGFPE", "SIGHUP", "SIGILL", "SIGINT", "SIGIO", "SIGIOT", "SIGKILL", "SIGPIPE", "SIGPOLL", "SIGPROF", "SIGPWR", "SIGQUIT", "SIGRTMAX", "SIGRTMAX-1", "SIGRTMAX-10", "SIGRTMAX-11", "SIGRTMAX-12", "SIGRTMAX-13", "SIGRTMAX-14", "SIGRTMAX-2", "SIGRTMAX-3", "SIGRTMAX-4", "SIGRTMAX-5", "SIGRTMAX-6", "SIGRTMAX-7", "SIGRTMAX-8", "SIGRTMAX-9", "SIGRTMIN", "SIGRTMIN+1", "SIGRTMIN+10", "SIGRTMIN+11", "SIGRTMIN+12", "SIGRTMIN+13", "SIGRTMIN+14", "SIGRTMIN+15", "SIGRTMIN+2", "SIGRTMIN+3", "SIGRTMIN+4", "SIGRTMIN+5", "SIGRTMIN+6", "SIGRTMIN+7", "SIGRTMIN+8", "SIGRTMIN+9", "SIGSEGV", "SIGSTKFLT", "SIGSTOP", "SIGSYS", "SIGTERM", "SIGTRAP", "SIGTSTP", "SIGTTIN", "SIGTTOU", "SIGURG", "SIGUSR1", "SIGUSR2", "SIGVTALRM", "SIGWINCH", "SIGXCPU", "SIGXFSZ"}, + }, + }, + }, + Required: []string{"name", "ready", "restartCount", "image", "imageID"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerState", "k8s.io/api/core/v1.ContainerUser", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.ResourceStatus", "k8s.io/api/core/v1.VolumeMountStatus", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_ContainerUser(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ContainerUser represents user identity information", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "linux": { + SchemaProps: spec.SchemaProps{ + Description: "Linux holds user identity information initially attached to the first process of the containers in Linux. Note that the actual running identity can be changed if the process has enough privilege to do so.", + Ref: ref("k8s.io/api/core/v1.LinuxContainerUser"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LinuxContainerUser"}, + } +} + +func schema_k8sio_api_core_v1_DaemonEndpoint(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "DaemonEndpoint contains information about a single Daemon endpoint.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "Port": { + SchemaProps: spec.SchemaProps{ + Description: "Port number of the given endpoint.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"Port"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_DownwardAPIProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents downward API info for projecting into a projected volume. Note that this is identical to a downwardAPI volume source without the default mode.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Items is a list of DownwardAPIVolume file", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeFile"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.DownwardAPIVolumeFile"}, + } +} + +func schema_k8sio_api_core_v1_DownwardAPIVolumeFile(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "DownwardAPIVolumeFile represents information to create the file containing the pod field", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Required: Path is the relative path name of the file to be created. Must not be absolute or contain the '..' path. Must be utf-8 encoded. The first item of the relative path must not start with '..'", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldRef": { + SchemaProps: spec.SchemaProps{ + Description: "Required: Selects a field of the pod: only annotations, labels, name, namespace and uid are supported.", + Ref: ref("k8s.io/api/core/v1.ObjectFieldSelector"), + }, + }, + "resourceFieldRef": { + SchemaProps: spec.SchemaProps{ + Description: "Selects a resource of the container: only resources limits and requests (limits.cpu, limits.memory, requests.cpu and requests.memory) are currently supported.", + Ref: ref("k8s.io/api/core/v1.ResourceFieldSelector"), + }, + }, + "mode": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: mode bits used to set permissions on this file, must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. If not specified, the volume defaultMode will be used. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"path"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ObjectFieldSelector", "k8s.io/api/core/v1.ResourceFieldSelector"}, + } +} + +func schema_k8sio_api_core_v1_DownwardAPIVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "DownwardAPIVolumeSource represents a volume containing downward API info. Downward API volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Items is a list of downward API volume file", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeFile"), + }, + }, + }, + }, + }, + "defaultMode": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: mode bits to use on created files by default. Must be a Optional: mode bits used to set permissions on created files by default. Must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. Defaults to 0644. Directories within the path are not affected by this setting. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.DownwardAPIVolumeFile"}, + } +} + +func schema_k8sio_api_core_v1_EmptyDirVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents an empty directory for a pod. Empty directory volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "medium": { + SchemaProps: spec.SchemaProps{ + Description: "medium represents what type of storage medium should back this directory. The default is \"\" which means to use the node's default medium. Must be an empty string (default) or Memory. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Type: []string{"string"}, + Format: "", + }, + }, + "sizeLimit": { + SchemaProps: spec.SchemaProps{ + Description: "sizeLimit is the total amount of local storage required for this EmptyDir volume. The size limit is also applicable for memory medium. The maximum usage on memory medium EmptyDir would be the minimum value between the SizeLimit specified here and the sum of memory limits of all containers in a pod. The default is nil which means that the limit is undefined. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_EndpointAddress(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EndpointAddress is a tuple that describes single IP address. Deprecated: This API is deprecated in v1.33+.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ip": { + SchemaProps: spec.SchemaProps{ + Description: "The IP of this endpoint. May not be loopback (127.0.0.0/8 or ::1), link-local (169.254.0.0/16 or fe80::/10), or link-local multicast (224.0.0.0/24 or ff02::/16).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "hostname": { + SchemaProps: spec.SchemaProps{ + Description: "The Hostname of this endpoint", + Type: []string{"string"}, + Format: "", + }, + }, + "nodeName": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: Node hosting this endpoint. This can be used to determine endpoints local to a node.", + Type: []string{"string"}, + Format: "", + }, + }, + "targetRef": { + SchemaProps: spec.SchemaProps{ + Description: "Reference to object providing the endpoint.", + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + }, + Required: []string{"ip"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_EndpointPort(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EndpointPort is a tuple that describes a single port. Deprecated: This API is deprecated in v1.33+.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The name of this port. This must match the 'name' field in the corresponding ServicePort. Must be a DNS_LABEL. Optional only if one port is defined.", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Description: "The port number of the endpoint.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "protocol": { + SchemaProps: spec.SchemaProps{ + Description: "The IP protocol for this port. Must be UDP, TCP, or SCTP. Default is TCP.\n\nPossible enum values:\n - `\"SCTP\"` is the SCTP protocol.\n - `\"TCP\"` is the TCP protocol.\n - `\"UDP\"` is the UDP protocol.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SCTP", "TCP", "UDP"}, + }, + }, + "appProtocol": { + SchemaProps: spec.SchemaProps{ + Description: "The application protocol for this port. This is used as a hint for implementations to offer richer behavior for protocols that they understand. This field follows standard Kubernetes label syntax. Valid values are either:\n\n* Un-prefixed protocol names - reserved for IANA standard service names (as per RFC-6335 and https://www.iana.org/assignments/service-names).\n\n* Kubernetes-defined prefixed names:\n * 'kubernetes.io/h2c' - HTTP/2 prior knowledge over cleartext as described in https://www.rfc-editor.org/rfc/rfc9113.html#name-starting-http-2-with-prior-\n * 'kubernetes.io/ws' - WebSocket over cleartext as described in https://www.rfc-editor.org/rfc/rfc6455\n * 'kubernetes.io/wss' - WebSocket over TLS as described in https://www.rfc-editor.org/rfc/rfc6455\n\n* Other protocols should use implementation-defined prefixed names such as mycompany.com/my-custom-protocol.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"port"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_EndpointSubset(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EndpointSubset is a group of addresses with a common set of ports. The expanded set of endpoints is the Cartesian product of Addresses x Ports. For example, given:\n\n\t{\n\t Addresses: [{\"ip\": \"10.10.1.1\"}, {\"ip\": \"10.10.2.2\"}],\n\t Ports: [{\"name\": \"a\", \"port\": 8675}, {\"name\": \"b\", \"port\": 309}]\n\t}\n\nThe resulting set of endpoints can be viewed as:\n\n\ta: [ 10.10.1.1:8675, 10.10.2.2:8675 ],\n\tb: [ 10.10.1.1:309, 10.10.2.2:309 ]\n\nDeprecated: This API is deprecated in v1.33+.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "addresses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "IP addresses which offer the related ports that are marked as ready. These endpoints should be considered safe for load balancers and clients to utilize.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EndpointAddress"), + }, + }, + }, + }, + }, + "notReadyAddresses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "IP addresses which offer the related ports but are not currently marked as ready because they have not yet finished starting, have recently failed a readiness check, or have recently failed a liveness check.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EndpointAddress"), + }, + }, + }, + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Port numbers available on the related IP addresses.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EndpointPort"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.EndpointAddress", "k8s.io/api/core/v1.EndpointPort"}, + } +} + +func schema_k8sio_api_core_v1_Endpoints(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Endpoints is a collection of endpoints that implement the actual service. Example:\n\n\t Name: \"mysvc\",\n\t Subsets: [\n\t {\n\t Addresses: [{\"ip\": \"10.10.1.1\"}, {\"ip\": \"10.10.2.2\"}],\n\t Ports: [{\"name\": \"a\", \"port\": 8675}, {\"name\": \"b\", \"port\": 309}]\n\t },\n\t {\n\t Addresses: [{\"ip\": \"10.10.3.3\"}],\n\t Ports: [{\"name\": \"a\", \"port\": 93}, {\"name\": \"b\", \"port\": 76}]\n\t },\n\t]\n\nEndpoints is a legacy API and does not contain information about all Service features. Use discoveryv1.EndpointSlice for complete information about Service endpoints.\n\nDeprecated: This API is deprecated in v1.33+. Use discoveryv1.EndpointSlice.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "subsets": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The set of all endpoints is the union of all subsets. Addresses are placed into subsets according to the IPs they share. A single address with multiple ports, some of which are ready and some of which are not (because they come from different containers) will result in the address being displayed in different subsets for the different ports. No address will appear in both Addresses and NotReadyAddresses in the same subset. Sets of addresses and ports that comprise a service.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EndpointSubset"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.EndpointSubset", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_EndpointsList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EndpointsList is a list of endpoints. Deprecated: This API is deprecated in v1.33+.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of endpoints.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Endpoints"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Endpoints", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_EnvFromSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EnvFromSource represents the source of a set of ConfigMaps or Secrets", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "prefix": { + SchemaProps: spec.SchemaProps{ + Description: "Optional text to prepend to the name of each environment variable. May consist of any printable ASCII characters except '='.", + Type: []string{"string"}, + Format: "", + }, + }, + "configMapRef": { + SchemaProps: spec.SchemaProps{ + Description: "The ConfigMap to select from", + Ref: ref("k8s.io/api/core/v1.ConfigMapEnvSource"), + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "The Secret to select from", + Ref: ref("k8s.io/api/core/v1.SecretEnvSource"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ConfigMapEnvSource", "k8s.io/api/core/v1.SecretEnvSource"}, + } +} + +func schema_k8sio_api_core_v1_EnvVar(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EnvVar represents an environment variable present in a Container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the environment variable. May consist of any printable ASCII characters except '='.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "Variable references $(VAR_NAME) are expanded using the previously defined environment variables in the container and any service environment variables. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Defaults to \"\".", + Type: []string{"string"}, + Format: "", + }, + }, + "valueFrom": { + SchemaProps: spec.SchemaProps{ + Description: "Source for the environment variable's value. Cannot be used if value is not empty.", + Ref: ref("k8s.io/api/core/v1.EnvVarSource"), + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.EnvVarSource"}, + } +} + +func schema_k8sio_api_core_v1_EnvVarSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EnvVarSource represents a source for the value of an EnvVar.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "fieldRef": { + SchemaProps: spec.SchemaProps{ + Description: "Selects a field of the pod: supports metadata.name, metadata.namespace, `metadata.labels['']`, `metadata.annotations['']`, spec.nodeName, spec.serviceAccountName, status.hostIP, status.podIP, status.podIPs.", + Ref: ref("k8s.io/api/core/v1.ObjectFieldSelector"), + }, + }, + "resourceFieldRef": { + SchemaProps: spec.SchemaProps{ + Description: "Selects a resource of the container: only resources limits and requests (limits.cpu, limits.memory, limits.ephemeral-storage, requests.cpu, requests.memory and requests.ephemeral-storage) are currently supported.", + Ref: ref("k8s.io/api/core/v1.ResourceFieldSelector"), + }, + }, + "configMapKeyRef": { + SchemaProps: spec.SchemaProps{ + Description: "Selects a key of a ConfigMap.", + Ref: ref("k8s.io/api/core/v1.ConfigMapKeySelector"), + }, + }, + "secretKeyRef": { + SchemaProps: spec.SchemaProps{ + Description: "Selects a key of a secret in the pod's namespace", + Ref: ref("k8s.io/api/core/v1.SecretKeySelector"), + }, + }, + "fileKeyRef": { + SchemaProps: spec.SchemaProps{ + Description: "FileKeyRef selects a key of the env file. Requires the EnvFiles feature gate to be enabled.", + Ref: ref("k8s.io/api/core/v1.FileKeySelector"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ConfigMapKeySelector", "k8s.io/api/core/v1.FileKeySelector", "k8s.io/api/core/v1.ObjectFieldSelector", "k8s.io/api/core/v1.ResourceFieldSelector", "k8s.io/api/core/v1.SecretKeySelector"}, + } +} + +func schema_k8sio_api_core_v1_EphemeralContainer(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "An EphemeralContainer is a temporary container that you may add to an existing Pod for user-initiated activities such as debugging. Ephemeral containers have no resource or scheduling guarantees, and they will not be restarted when they exit or when a Pod is removed or restarted. The kubelet may evict a Pod if an ephemeral container causes the Pod to exceed its resource allocation.\n\nTo add an ephemeral container, use the ephemeralcontainers subresource of an existing Pod. Ephemeral containers may not be removed or restarted.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the ephemeral container specified as a DNS_LABEL. This name must be unique among all containers, init containers and ephemeral containers.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "Container image name. More info: https://kubernetes.io/docs/concepts/containers/images", + Type: []string{"string"}, + Format: "", + }, + }, + "command": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Entrypoint array. Not executed within a shell. The image's ENTRYPOINT is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "args": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Arguments to the entrypoint. The image's CMD is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "workingDir": { + SchemaProps: spec.SchemaProps{ + Description: "Container's working directory. If not specified, the container runtime's default will be used, which might be configured in the container image. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "containerPort", + "protocol", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "containerPort", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Ports are not allowed for ephemeral containers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerPort"), + }, + }, + }, + }, + }, + "envFrom": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of sources to populate environment variables in the container. The keys defined within a source may consist of any printable ASCII characters except '='. When a key exists in multiple sources, the value associated with the last source will take precedence. Values defined by an Env with a duplicate key will take precedence. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvFromSource"), + }, + }, + }, + }, + }, + "env": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of environment variables to set in the container. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvVar"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Resources are not allowed for ephemeral containers. Ephemeral containers use spare resources already allocated to the pod.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "resizePolicy": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Resources resize policy for the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerResizePolicy"), + }, + }, + }, + }, + }, + "restartPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Restart policy for the container to manage the restart behavior of each container within a pod. You cannot set this field on ephemeral containers.", + Type: []string{"string"}, + Format: "", + }, + }, + "restartPolicyRules": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Represents a list of rules to be checked to determine if the container should be restarted on exit. You cannot set this field on ephemeral containers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerRestartRule"), + }, + }, + }, + }, + }, + "volumeMounts": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "mountPath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "mountPath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Pod volumes to mount into the container's filesystem. Subpath mounts are not allowed for ephemeral containers. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeMount"), + }, + }, + }, + }, + }, + "volumeDevices": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "devicePath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "devicePath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "volumeDevices is the list of block devices to be used by the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeDevice"), + }, + }, + }, + }, + }, + "livenessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "readinessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "startupProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "lifecycle": { + SchemaProps: spec.SchemaProps{ + Description: "Lifecycle is not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Lifecycle"), + }, + }, + "terminationMessagePath": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: Path at which the file to which the container's termination message will be written is mounted into the container's filesystem. Message written is intended to be brief final status, such as an assertion failure message. Will be truncated by the node if greater than 4096 bytes. The total message length across all containers will be limited to 12kb. Defaults to /dev/termination-log. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "terminationMessagePolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Indicate how the termination message should be populated. File will use the contents of terminationMessagePath to populate the container status message on both success and failure. FallbackToLogsOnError will use the last chunk of container log output if the termination message file is empty and the container exited with an error. The log output is limited to 2048 bytes or 80 lines, whichever is smaller. Defaults to File. Cannot be updated.\n\nPossible enum values:\n - `\"FallbackToLogsOnError\"` will read the most recent contents of the container logs for the container status message when the container exits with an error and the terminationMessagePath has no contents.\n - `\"File\"` is the default behavior and will set the container status message to the contents of the container's terminationMessagePath when the container exits.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"FallbackToLogsOnError", "File"}, + }, + }, + "imagePullPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Image pull policy. One of Always, Never, IfNotPresent. Defaults to Always if :latest tag is specified, or IfNotPresent otherwise. Cannot be updated. More info: https://kubernetes.io/docs/concepts/containers/images#updating-images\n\nPossible enum values:\n - `\"Always\"` means that kubelet always attempts to pull the latest image. Container will fail If the pull fails.\n - `\"IfNotPresent\"` means that kubelet pulls if the image isn't present on disk. Container will fail if the image isn't present and the pull fails.\n - `\"Never\"` means that kubelet never pulls an image, but only uses a local image. Container will fail if the image isn't present", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "IfNotPresent", "Never"}, + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: SecurityContext defines the security options the ephemeral container should be run with. If set, the fields of SecurityContext override the equivalent fields of PodSecurityContext.", + Ref: ref("k8s.io/api/core/v1.SecurityContext"), + }, + }, + "stdin": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a buffer for stdin in the container runtime. If this is not set, reads from stdin in the container will always result in EOF. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stdinOnce": { + SchemaProps: spec.SchemaProps{ + Description: "Whether the container runtime should close the stdin channel after it has been opened by a single attach. When stdin is true the stdin stream will remain open across multiple attach sessions. If stdinOnce is set to true, stdin is opened on container start, is empty until the first client attaches to stdin, and then remains open and accepts data until the client disconnects, at which time stdin is closed and remains closed until the container is restarted. If this flag is false, a container processes that reads from stdin will never receive an EOF. Default is false", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tty": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a TTY for itself, also requires 'stdin' to be true. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "targetContainerName": { + SchemaProps: spec.SchemaProps{ + Description: "If set, the name of the container from PodSpec that this ephemeral container targets. The ephemeral container will be run in the namespaces (IPC, PID, etc) of this container. If not set then the ephemeral container uses the namespaces configured in the Pod spec.\n\nThe container runtime must implement support for this feature. If the runtime does not support namespace targeting then the result of setting this field is undefined.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerPort", "k8s.io/api/core/v1.ContainerResizePolicy", "k8s.io/api/core/v1.ContainerRestartRule", "k8s.io/api/core/v1.EnvFromSource", "k8s.io/api/core/v1.EnvVar", "k8s.io/api/core/v1.Lifecycle", "k8s.io/api/core/v1.Probe", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.SecurityContext", "k8s.io/api/core/v1.VolumeDevice", "k8s.io/api/core/v1.VolumeMount"}, + } +} + +func schema_k8sio_api_core_v1_EphemeralContainerCommon(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EphemeralContainerCommon is a copy of all fields in Container to be inlined in EphemeralContainer. This separate type allows easy conversion from EphemeralContainer to Container and allows separate documentation for the fields of EphemeralContainer. When a new field is added to Container it must be added here as well.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the ephemeral container specified as a DNS_LABEL. This name must be unique among all containers, init containers and ephemeral containers.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "Container image name. More info: https://kubernetes.io/docs/concepts/containers/images", + Type: []string{"string"}, + Format: "", + }, + }, + "command": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Entrypoint array. Not executed within a shell. The image's ENTRYPOINT is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "args": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Arguments to the entrypoint. The image's CMD is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. Double $$ are reduced to a single $, which allows for escaping the $(VAR_NAME) syntax: i.e. \"$$(VAR_NAME)\" will produce the string literal \"$(VAR_NAME)\". Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "workingDir": { + SchemaProps: spec.SchemaProps{ + Description: "Container's working directory. If not specified, the container runtime's default will be used, which might be configured in the container image. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "containerPort", + "protocol", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "containerPort", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Ports are not allowed for ephemeral containers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerPort"), + }, + }, + }, + }, + }, + "envFrom": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of sources to populate environment variables in the container. The keys defined within a source may consist of any printable ASCII characters except '='. When a key exists in multiple sources, the value associated with the last source will take precedence. Values defined by an Env with a duplicate key will take precedence. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvFromSource"), + }, + }, + }, + }, + }, + "env": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of environment variables to set in the container. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvVar"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Resources are not allowed for ephemeral containers. Ephemeral containers use spare resources already allocated to the pod.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "resizePolicy": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Resources resize policy for the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerResizePolicy"), + }, + }, + }, + }, + }, + "restartPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Restart policy for the container to manage the restart behavior of each container within a pod. You cannot set this field on ephemeral containers.", + Type: []string{"string"}, + Format: "", + }, + }, + "restartPolicyRules": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Represents a list of rules to be checked to determine if the container should be restarted on exit. You cannot set this field on ephemeral containers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerRestartRule"), + }, + }, + }, + }, + }, + "volumeMounts": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "mountPath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "mountPath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Pod volumes to mount into the container's filesystem. Subpath mounts are not allowed for ephemeral containers. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeMount"), + }, + }, + }, + }, + }, + "volumeDevices": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "devicePath", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "devicePath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "volumeDevices is the list of block devices to be used by the container.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeDevice"), + }, + }, + }, + }, + }, + "livenessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "readinessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "startupProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Probes are not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "lifecycle": { + SchemaProps: spec.SchemaProps{ + Description: "Lifecycle is not allowed for ephemeral containers.", + Ref: ref("k8s.io/api/core/v1.Lifecycle"), + }, + }, + "terminationMessagePath": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: Path at which the file to which the container's termination message will be written is mounted into the container's filesystem. Message written is intended to be brief final status, such as an assertion failure message. Will be truncated by the node if greater than 4096 bytes. The total message length across all containers will be limited to 12kb. Defaults to /dev/termination-log. Cannot be updated.", + Type: []string{"string"}, + Format: "", + }, + }, + "terminationMessagePolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Indicate how the termination message should be populated. File will use the contents of terminationMessagePath to populate the container status message on both success and failure. FallbackToLogsOnError will use the last chunk of container log output if the termination message file is empty and the container exited with an error. The log output is limited to 2048 bytes or 80 lines, whichever is smaller. Defaults to File. Cannot be updated.\n\nPossible enum values:\n - `\"FallbackToLogsOnError\"` will read the most recent contents of the container logs for the container status message when the container exits with an error and the terminationMessagePath has no contents.\n - `\"File\"` is the default behavior and will set the container status message to the contents of the container's terminationMessagePath when the container exits.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"FallbackToLogsOnError", "File"}, + }, + }, + "imagePullPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Image pull policy. One of Always, Never, IfNotPresent. Defaults to Always if :latest tag is specified, or IfNotPresent otherwise. Cannot be updated. More info: https://kubernetes.io/docs/concepts/containers/images#updating-images\n\nPossible enum values:\n - `\"Always\"` means that kubelet always attempts to pull the latest image. Container will fail If the pull fails.\n - `\"IfNotPresent\"` means that kubelet pulls if the image isn't present on disk. Container will fail if the image isn't present and the pull fails.\n - `\"Never\"` means that kubelet never pulls an image, but only uses a local image. Container will fail if the image isn't present", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "IfNotPresent", "Never"}, + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: SecurityContext defines the security options the ephemeral container should be run with. If set, the fields of SecurityContext override the equivalent fields of PodSecurityContext.", + Ref: ref("k8s.io/api/core/v1.SecurityContext"), + }, + }, + "stdin": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a buffer for stdin in the container runtime. If this is not set, reads from stdin in the container will always result in EOF. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stdinOnce": { + SchemaProps: spec.SchemaProps{ + Description: "Whether the container runtime should close the stdin channel after it has been opened by a single attach. When stdin is true the stdin stream will remain open across multiple attach sessions. If stdinOnce is set to true, stdin is opened on container start, is empty until the first client attaches to stdin, and then remains open and accepts data until the client disconnects, at which time stdin is closed and remains closed until the container is restarted. If this flag is false, a container processes that reads from stdin will never receive an EOF. Default is false", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tty": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container should allocate a TTY for itself, also requires 'stdin' to be true. Default is false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerPort", "k8s.io/api/core/v1.ContainerResizePolicy", "k8s.io/api/core/v1.ContainerRestartRule", "k8s.io/api/core/v1.EnvFromSource", "k8s.io/api/core/v1.EnvVar", "k8s.io/api/core/v1.Lifecycle", "k8s.io/api/core/v1.Probe", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.SecurityContext", "k8s.io/api/core/v1.VolumeDevice", "k8s.io/api/core/v1.VolumeMount"}, + } +} + +func schema_k8sio_api_core_v1_EphemeralVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents an ephemeral volume that is handled by a normal storage driver.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeClaimTemplate": { + SchemaProps: spec.SchemaProps{ + Description: "Will be used to create a stand-alone PVC to provision the volume. The pod in which this EphemeralVolumeSource is embedded will be the owner of the PVC, i.e. the PVC will be deleted together with the pod. The name of the PVC will be `-` where `` is the name from the `PodSpec.Volumes` array entry. Pod validation will reject the pod if the concatenated name is not valid for a PVC (for example, too long).\n\nAn existing PVC with that name that is not owned by the pod will *not* be used for the pod to avoid using an unrelated volume by mistake. Starting the pod is then blocked until the unrelated PVC is removed. If such a pre-created PVC is meant to be used by the pod, the PVC has to updated with an owner reference to the pod once the pod exists. Normally this should not be necessary, but it may be useful when manually reconstructing a broken cluster.\n\nThis field is read-only and no changes will be made by Kubernetes to the PVC after it has been created.\n\nRequired, must not be nil.", + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimTemplate"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaimTemplate"}, + } +} + +func schema_k8sio_api_core_v1_Event(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Event is a report of an event somewhere in the cluster. Events have a limited retention time and triggers and messages may evolve with time. Event consumers should not rely on the timing of an event with a given Reason reflecting a consistent underlying trigger, or the continued existence of events with that Reason. Events should be treated as informative, best-effort, supplemental data.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "involvedObject": { + SchemaProps: spec.SchemaProps{ + Description: "The object that this event is about.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "This should be a short, machine understandable string that gives the reason for the transition into the object's current status.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human-readable description of the status of this operation.", + Type: []string{"string"}, + Format: "", + }, + }, + "source": { + SchemaProps: spec.SchemaProps{ + Description: "The component reporting this event. Should be a short machine understandable string.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EventSource"), + }, + }, + "firstTimestamp": { + SchemaProps: spec.SchemaProps{ + Description: "The time at which the event was first recorded. (Time of server receipt is in TypeMeta.)", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "lastTimestamp": { + SchemaProps: spec.SchemaProps{ + Description: "The time at which the most recent occurrence of this event was recorded.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "count": { + SchemaProps: spec.SchemaProps{ + Description: "The number of times this event has occurred.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of this event (Normal, Warning), new types could be added in the future", + Type: []string{"string"}, + Format: "", + }, + }, + "eventTime": { + SchemaProps: spec.SchemaProps{ + Description: "Time when this Event was first observed.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.MicroTime"), + }, + }, + "series": { + SchemaProps: spec.SchemaProps{ + Description: "Data about the Event series this event represents or nil if it's a singleton Event.", + Ref: ref("k8s.io/api/core/v1.EventSeries"), + }, + }, + "action": { + SchemaProps: spec.SchemaProps{ + Description: "What action was taken/failed regarding to the Regarding object.", + Type: []string{"string"}, + Format: "", + }, + }, + "related": { + SchemaProps: spec.SchemaProps{ + Description: "Optional secondary object for more complex actions.", + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + "reportingComponent": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the controller that emitted this Event, e.g. `kubernetes.io/kubelet`.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "reportingInstance": { + SchemaProps: spec.SchemaProps{ + Description: "ID of the controller instance, e.g. `kubelet-xyzf`.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"metadata", "involvedObject"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.EventSeries", "k8s.io/api/core/v1.EventSource", "k8s.io/api/core/v1.ObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.MicroTime", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta", "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_EventList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EventList is a list of events.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of events", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Event"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Event", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_EventSeries(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EventSeries contain information on series of events, i.e. thing that was/is happening continuously for some time.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "count": { + SchemaProps: spec.SchemaProps{ + Description: "Number of occurrences in this series up to the last heartbeat time", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "lastObservedTime": { + SchemaProps: spec.SchemaProps{ + Description: "Time of the last occurrence observed", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.MicroTime"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.MicroTime"}, + } +} + +func schema_k8sio_api_core_v1_EventSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EventSource contains information for an event.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "component": { + SchemaProps: spec.SchemaProps{ + Description: "Component from which the event is generated.", + Type: []string{"string"}, + Format: "", + }, + }, + "host": { + SchemaProps: spec.SchemaProps{ + Description: "Node name on which the event is generated.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ExecAction(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ExecAction describes a \"run in container\" action.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "command": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Command is the command line to execute inside the container, the working directory for the command is root ('/') in the container's filesystem. The command is simply exec'd, it is not run inside a shell, so traditional shell instructions ('|', etc) won't work. To use a shell, you need to explicitly call out to that shell. Exit status of 0 is treated as live/healthy and non-zero is unhealthy.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_FCVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Fibre Channel volume. Fibre Channel volumes can only be mounted as read/write once. Fibre Channel volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "targetWWNs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "targetWWNs is Optional: FC target worldwide names (WWNs)", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "lun": { + SchemaProps: spec.SchemaProps{ + Description: "lun is Optional: FC target lun number", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "wwids": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "wwids Optional: FC volume world wide identifiers (wwids) Either wwids or combination of targetWWNs and lun must be set, but not both simultaneously.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_FileKeySelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "FileKeySelector selects a key of the env file.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "The name of the volume mount containing the env file.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "The path within the volume from which to select the file. Must be relative and may not contain the '..' path or start with '..'.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "key": { + SchemaProps: spec.SchemaProps{ + Description: "The key within the env file. An invalid key will prevent the pod from starting. The keys defined within a source may consist of any printable ASCII characters except '='. During Alpha stage of the EnvFiles feature gate, the key size is limited to 128 characters.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "Specify whether the file or its key must be defined. If the file or key does not exist, then the env var is not published. If optional is set to true and the specified key does not exist, the environment variable will not be set in the Pod's containers.\n\nIf optional is set to false and the specified key does not exist, an error will be returned during Pod creation.", + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"volumeName", "path", "key"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_FlexPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "FlexPersistentVolumeSource represents a generic persistent volume resource that is provisioned/attached using an exec based plugin.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "driver": { + SchemaProps: spec.SchemaProps{ + Description: "driver is the name of the driver to use for this volume.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the Filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". The default filesystem depends on FlexVolume script.", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is Optional: SecretRef is reference to the secret object containing sensitive information to pass to the plugin scripts. This may be empty if no secret object is specified. If the secret object contains more than one secret, all secrets are passed to the plugin scripts.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "options": { + SchemaProps: spec.SchemaProps{ + Description: "options is Optional: this field holds extra command options if any.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"driver"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_FlexVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "FlexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "driver": { + SchemaProps: spec.SchemaProps{ + Description: "driver is the name of the driver to use for this volume.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". The default filesystem depends on FlexVolume script.", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is Optional: secretRef is reference to the secret object containing sensitive information to pass to the plugin scripts. This may be empty if no secret object is specified. If the secret object contains more than one secret, all secrets are passed to the plugin scripts.", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly is Optional: defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "options": { + SchemaProps: spec.SchemaProps{ + Description: "options is Optional: this field holds extra command options if any.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"driver"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_FlockerVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Flocker volume mounted by the Flocker agent. One and only one of datasetName and datasetUUID should be set. Flocker volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "datasetName": { + SchemaProps: spec.SchemaProps{ + Description: "datasetName is Name of the dataset stored as metadata -> name on the dataset for Flocker should be considered as deprecated", + Type: []string{"string"}, + Format: "", + }, + }, + "datasetUUID": { + SchemaProps: spec.SchemaProps{ + Description: "datasetUUID is the UUID of the dataset. This is unique identifier of a Flocker dataset", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_GCEPersistentDiskVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Persistent Disk resource in Google Compute Engine.\n\nA GCE PD must exist before mounting to a container. The disk must also be in the same GCE project and zone as the kubelet. A GCE PD can only be mounted as read/write once or read-only many times. GCE PDs support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "pdName": { + SchemaProps: spec.SchemaProps{ + Description: "pdName is unique name of the PD resource in GCE. Used to identify the disk in GCE. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Type: []string{"string"}, + Format: "", + }, + }, + "partition": { + SchemaProps: spec.SchemaProps{ + Description: "partition is the partition in the volume that you want to mount. If omitted, the default is to mount by volume name. Examples: For volume /dev/sda1, you specify the partition as \"1\". Similarly, the volume partition for /dev/sda is \"0\" (or you can leave the property empty). More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the ReadOnly setting in VolumeMounts. Defaults to false. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"pdName"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_GRPCAction(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GRPCAction specifies an action involving a GRPC service.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "port": { + SchemaProps: spec.SchemaProps{ + Description: "Port number of the gRPC service. Number must be in the range 1 to 65535.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "service": { + SchemaProps: spec.SchemaProps{ + Description: "Service is the name of the service to place in the gRPC HealthCheckRequest (see https://github.com/grpc/grpc/blob/master/doc/health-checking.md).\n\nIf this is not specified, the default behavior is defined by gRPC.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"port"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_GitRepoVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a volume that is populated with the contents of a git repository. Git repo volumes do not support ownership management. Git repo volumes support SELinux relabeling.\n\nDEPRECATED: GitRepo is deprecated. To provision a container with a git repo, mount an EmptyDir into an InitContainer that clones the repo using git, then mount the EmptyDir into the Pod's container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "repository": { + SchemaProps: spec.SchemaProps{ + Description: "repository is the URL", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "revision": { + SchemaProps: spec.SchemaProps{ + Description: "revision is the commit hash for the specified revision.", + Type: []string{"string"}, + Format: "", + }, + }, + "directory": { + SchemaProps: spec.SchemaProps{ + Description: "directory is the target directory name. Must not contain or start with '..'. If '.' is supplied, the volume directory will be the git repository. Otherwise, if specified, the volume will contain the git repository in the subdirectory with the given name.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"repository"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_GlusterfsPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Glusterfs mount that lasts the lifetime of a pod. Glusterfs volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "endpoints": { + SchemaProps: spec.SchemaProps{ + Description: "endpoints is the endpoint name that details Glusterfs topology. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is the Glusterfs volume path. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the Glusterfs volume to be mounted with read-only permissions. Defaults to false. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Type: []string{"boolean"}, + Format: "", + }, + }, + "endpointsNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "endpointsNamespace is the namespace that contains Glusterfs endpoint. If this field is empty, the EndpointNamespace defaults to the same namespace as the bound PVC. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"endpoints", "path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_GlusterfsVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Glusterfs mount that lasts the lifetime of a pod. Glusterfs volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "endpoints": { + SchemaProps: spec.SchemaProps{ + Description: "endpoints is the endpoint name that details Glusterfs topology.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is the Glusterfs volume path. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the Glusterfs volume to be mounted with read-only permissions. Defaults to false. More info: https://examples.k8s.io/volumes/glusterfs/README.md#create-a-pod", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"endpoints", "path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_HTTPGetAction(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "HTTPGetAction describes an action based on HTTP Get requests.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Path to access on the HTTP server.", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Description: "Name or number of the port to access on the container. Number must be in the range 1 to 65535. Name must be an IANA_SVC_NAME.", + Ref: ref("k8s.io/apimachinery/pkg/util/intstr.IntOrString"), + }, + }, + "host": { + SchemaProps: spec.SchemaProps{ + Description: "Host name to connect to, defaults to the pod IP. You probably want to set \"Host\" in httpHeaders instead.", + Type: []string{"string"}, + Format: "", + }, + }, + "scheme": { + SchemaProps: spec.SchemaProps{ + Description: "Scheme to use for connecting to the host. Defaults to HTTP.\n\nPossible enum values:\n - `\"HTTP\"` means that the scheme used will be http://\n - `\"HTTPS\"` means that the scheme used will be https://", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"HTTP", "HTTPS"}, + }, + }, + "httpHeaders": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Custom headers to set in the request. HTTP allows repeated headers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.HTTPHeader"), + }, + }, + }, + }, + }, + }, + Required: []string{"port"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.HTTPHeader", "k8s.io/apimachinery/pkg/util/intstr.IntOrString"}, + } +} + +func schema_k8sio_api_core_v1_HTTPHeader(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "HTTPHeader describes a custom header to be used in HTTP probes", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The header field name. This will be canonicalized upon output, so case-variant names will be understood as the same header.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "The header field value", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "value"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_HostAlias(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "HostAlias holds the mapping between IP and hostnames that will be injected as an entry in the pod's hosts file.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ip": { + SchemaProps: spec.SchemaProps{ + Description: "IP address of the host file entry.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "hostnames": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Hostnames for the above IP address.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"ip"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_HostIP(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "HostIP represents a single IP address allocated to the host.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ip": { + SchemaProps: spec.SchemaProps{ + Description: "IP is the IP address assigned to the host", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"ip"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_HostPathVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a host path mapped into a pod. Host path volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path of the directory on the host. If the path is a symlink, it will follow the link to the real path. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type for HostPath Volume Defaults to \"\" More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath\n\nPossible enum values:\n - `\"\"` For backwards compatible, leave it empty if unset\n - `\"BlockDevice\"` A block device must exist at the given path\n - `\"CharDevice\"` A character device must exist at the given path\n - `\"Directory\"` A directory must exist at the given path\n - `\"DirectoryOrCreate\"` If nothing exists at the given path, an empty directory will be created there as needed with file mode 0755, having the same group and ownership with Kubelet.\n - `\"File\"` A file must exist at the given path\n - `\"FileOrCreate\"` If nothing exists at the given path, an empty file will be created there as needed with file mode 0644, having the same group and ownership with Kubelet.\n - `\"Socket\"` A UNIX socket must exist at the given path", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"", "BlockDevice", "CharDevice", "Directory", "DirectoryOrCreate", "File", "FileOrCreate", "Socket"}, + }, + }, + }, + Required: []string{"path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ISCSIPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ISCSIPersistentVolumeSource represents an ISCSI disk. ISCSI volumes can only be mounted as read/write once. ISCSI volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "targetPortal": { + SchemaProps: spec.SchemaProps{ + Description: "targetPortal is iSCSI Target Portal. The Portal is either an IP or ip_addr:port if the port is other than default (typically TCP ports 860 and 3260).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "iqn": { + SchemaProps: spec.SchemaProps{ + Description: "iqn is Target iSCSI Qualified Name.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lun": { + SchemaProps: spec.SchemaProps{ + Description: "lun is iSCSI Target Lun number.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "iscsiInterface": { + SchemaProps: spec.SchemaProps{ + Description: "iscsiInterface is the interface Name that uses an iSCSI transport. Defaults to 'default' (tcp).", + Default: "default", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#iscsi", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the ReadOnly setting in VolumeMounts. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "portals": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "portals is the iSCSI Target Portal List. The Portal is either an IP or ip_addr:port if the port is other than default (typically TCP ports 860 and 3260).", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "chapAuthDiscovery": { + SchemaProps: spec.SchemaProps{ + Description: "chapAuthDiscovery defines whether support iSCSI Discovery CHAP authentication", + Type: []string{"boolean"}, + Format: "", + }, + }, + "chapAuthSession": { + SchemaProps: spec.SchemaProps{ + Description: "chapAuthSession defines whether support iSCSI Session CHAP authentication", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is the CHAP Secret for iSCSI target and initiator authentication", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "initiatorName": { + SchemaProps: spec.SchemaProps{ + Description: "initiatorName is the custom iSCSI Initiator Name. If initiatorName is specified with iscsiInterface simultaneously, new iSCSI interface : will be created for the connection.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"targetPortal", "iqn", "lun"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_ISCSIVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents an ISCSI disk. ISCSI volumes can only be mounted as read/write once. ISCSI volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "targetPortal": { + SchemaProps: spec.SchemaProps{ + Description: "targetPortal is iSCSI Target Portal. The Portal is either an IP or ip_addr:port if the port is other than default (typically TCP ports 860 and 3260).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "iqn": { + SchemaProps: spec.SchemaProps{ + Description: "iqn is the target iSCSI Qualified Name.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lun": { + SchemaProps: spec.SchemaProps{ + Description: "lun represents iSCSI Target Lun number.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "iscsiInterface": { + SchemaProps: spec.SchemaProps{ + Description: "iscsiInterface is the interface Name that uses an iSCSI transport. Defaults to 'default' (tcp).", + Default: "default", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#iscsi", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the ReadOnly setting in VolumeMounts. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "portals": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "portals is the iSCSI Target Portal List. The portal is either an IP or ip_addr:port if the port is other than default (typically TCP ports 860 and 3260).", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "chapAuthDiscovery": { + SchemaProps: spec.SchemaProps{ + Description: "chapAuthDiscovery defines whether support iSCSI Discovery CHAP authentication", + Type: []string{"boolean"}, + Format: "", + }, + }, + "chapAuthSession": { + SchemaProps: spec.SchemaProps{ + Description: "chapAuthSession defines whether support iSCSI Session CHAP authentication", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is the CHAP Secret for iSCSI target and initiator authentication", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "initiatorName": { + SchemaProps: spec.SchemaProps{ + Description: "initiatorName is the custom iSCSI Initiator Name. If initiatorName is specified with iscsiInterface simultaneously, new iSCSI interface : will be created for the connection.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"targetPortal", "iqn", "lun"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_ImageVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ImageVolumeSource represents a image volume resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "reference": { + SchemaProps: spec.SchemaProps{ + Description: "Required: Image or artifact reference to be used. Behaves in the same way as pod.spec.containers[*].image. Pull secrets will be assembled in the same way as for the container image by looking up node credentials, SA image pull secrets, and pod spec image pull secrets. More info: https://kubernetes.io/docs/concepts/containers/images This field is optional to allow higher level config management to default or override container images in workload controllers like Deployments and StatefulSets.", + Type: []string{"string"}, + Format: "", + }, + }, + "pullPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Policy for pulling OCI objects. Possible values are: Always: the kubelet always attempts to pull the reference. Container creation will fail If the pull fails. Never: the kubelet never pulls the reference and only uses a local image or artifact. Container creation will fail if the reference isn't present. IfNotPresent: the kubelet pulls if the reference isn't already present on disk. Container creation will fail if the reference isn't present and the pull fails. Defaults to Always if :latest tag is specified, or IfNotPresent otherwise.\n\nPossible enum values:\n - `\"Always\"` means that kubelet always attempts to pull the latest image. Container will fail If the pull fails.\n - `\"IfNotPresent\"` means that kubelet pulls if the image isn't present on disk. Container will fail if the image isn't present and the pull fails.\n - `\"Never\"` means that kubelet never pulls an image, but only uses a local image. Container will fail if the image isn't present", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "IfNotPresent", "Never"}, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_KeyToPath(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Maps a string key to a path within a volume.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "key is the key to project.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is the relative path of the file to map the key to. May not be an absolute path. May not contain the path element '..'. May not start with the string '..'.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "mode": { + SchemaProps: spec.SchemaProps{ + Description: "mode is Optional: mode bits used to set permissions on this file. Must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. If not specified, the volume defaultMode will be used. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"key", "path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Lifecycle(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Lifecycle describes actions that the management system should take in response to container lifecycle events. For the PostStart and PreStop lifecycle handlers, management of the container blocks until the action is complete, unless the container process fails, in which case the handler is aborted.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "postStart": { + SchemaProps: spec.SchemaProps{ + Description: "PostStart is called immediately after a container is created. If the handler fails, the container is terminated and restarted according to its restart policy. Other management of the container blocks until the hook completes. More info: https://kubernetes.io/docs/concepts/containers/container-lifecycle-hooks/#container-hooks", + Ref: ref("k8s.io/api/core/v1.LifecycleHandler"), + }, + }, + "preStop": { + SchemaProps: spec.SchemaProps{ + Description: "PreStop is called immediately before a container is terminated due to an API request or management event such as liveness/startup probe failure, preemption, resource contention, etc. The handler is not called if the container crashes or exits. The Pod's termination grace period countdown begins before the PreStop hook is executed. Regardless of the outcome of the handler, the container will eventually terminate within the Pod's termination grace period (unless delayed by finalizers). Other management of the container blocks until the hook completes or until the termination grace period is reached. More info: https://kubernetes.io/docs/concepts/containers/container-lifecycle-hooks/#container-hooks", + Ref: ref("k8s.io/api/core/v1.LifecycleHandler"), + }, + }, + "stopSignal": { + SchemaProps: spec.SchemaProps{ + Description: "StopSignal defines which signal will be sent to a container when it is being stopped. If not specified, the default is defined by the container runtime in use. StopSignal can only be set for Pods with a non-empty .spec.os.name\n\nPossible enum values:\n - `\"SIGABRT\"`\n - `\"SIGALRM\"`\n - `\"SIGBUS\"`\n - `\"SIGCHLD\"`\n - `\"SIGCLD\"`\n - `\"SIGCONT\"`\n - `\"SIGFPE\"`\n - `\"SIGHUP\"`\n - `\"SIGILL\"`\n - `\"SIGINT\"`\n - `\"SIGIO\"`\n - `\"SIGIOT\"`\n - `\"SIGKILL\"`\n - `\"SIGPIPE\"`\n - `\"SIGPOLL\"`\n - `\"SIGPROF\"`\n - `\"SIGPWR\"`\n - `\"SIGQUIT\"`\n - `\"SIGRTMAX\"`\n - `\"SIGRTMAX-1\"`\n - `\"SIGRTMAX-10\"`\n - `\"SIGRTMAX-11\"`\n - `\"SIGRTMAX-12\"`\n - `\"SIGRTMAX-13\"`\n - `\"SIGRTMAX-14\"`\n - `\"SIGRTMAX-2\"`\n - `\"SIGRTMAX-3\"`\n - `\"SIGRTMAX-4\"`\n - `\"SIGRTMAX-5\"`\n - `\"SIGRTMAX-6\"`\n - `\"SIGRTMAX-7\"`\n - `\"SIGRTMAX-8\"`\n - `\"SIGRTMAX-9\"`\n - `\"SIGRTMIN\"`\n - `\"SIGRTMIN+1\"`\n - `\"SIGRTMIN+10\"`\n - `\"SIGRTMIN+11\"`\n - `\"SIGRTMIN+12\"`\n - `\"SIGRTMIN+13\"`\n - `\"SIGRTMIN+14\"`\n - `\"SIGRTMIN+15\"`\n - `\"SIGRTMIN+2\"`\n - `\"SIGRTMIN+3\"`\n - `\"SIGRTMIN+4\"`\n - `\"SIGRTMIN+5\"`\n - `\"SIGRTMIN+6\"`\n - `\"SIGRTMIN+7\"`\n - `\"SIGRTMIN+8\"`\n - `\"SIGRTMIN+9\"`\n - `\"SIGSEGV\"`\n - `\"SIGSTKFLT\"`\n - `\"SIGSTOP\"`\n - `\"SIGSYS\"`\n - `\"SIGTERM\"`\n - `\"SIGTRAP\"`\n - `\"SIGTSTP\"`\n - `\"SIGTTIN\"`\n - `\"SIGTTOU\"`\n - `\"SIGURG\"`\n - `\"SIGUSR1\"`\n - `\"SIGUSR2\"`\n - `\"SIGVTALRM\"`\n - `\"SIGWINCH\"`\n - `\"SIGXCPU\"`\n - `\"SIGXFSZ\"`", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SIGABRT", "SIGALRM", "SIGBUS", "SIGCHLD", "SIGCLD", "SIGCONT", "SIGFPE", "SIGHUP", "SIGILL", "SIGINT", "SIGIO", "SIGIOT", "SIGKILL", "SIGPIPE", "SIGPOLL", "SIGPROF", "SIGPWR", "SIGQUIT", "SIGRTMAX", "SIGRTMAX-1", "SIGRTMAX-10", "SIGRTMAX-11", "SIGRTMAX-12", "SIGRTMAX-13", "SIGRTMAX-14", "SIGRTMAX-2", "SIGRTMAX-3", "SIGRTMAX-4", "SIGRTMAX-5", "SIGRTMAX-6", "SIGRTMAX-7", "SIGRTMAX-8", "SIGRTMAX-9", "SIGRTMIN", "SIGRTMIN+1", "SIGRTMIN+10", "SIGRTMIN+11", "SIGRTMIN+12", "SIGRTMIN+13", "SIGRTMIN+14", "SIGRTMIN+15", "SIGRTMIN+2", "SIGRTMIN+3", "SIGRTMIN+4", "SIGRTMIN+5", "SIGRTMIN+6", "SIGRTMIN+7", "SIGRTMIN+8", "SIGRTMIN+9", "SIGSEGV", "SIGSTKFLT", "SIGSTOP", "SIGSYS", "SIGTERM", "SIGTRAP", "SIGTSTP", "SIGTTIN", "SIGTTOU", "SIGURG", "SIGUSR1", "SIGUSR2", "SIGVTALRM", "SIGWINCH", "SIGXCPU", "SIGXFSZ"}, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LifecycleHandler"}, + } +} + +func schema_k8sio_api_core_v1_LifecycleHandler(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LifecycleHandler defines a specific action that should be taken in a lifecycle hook. One and only one of the fields, except TCPSocket must be specified.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "exec": { + SchemaProps: spec.SchemaProps{ + Description: "Exec specifies a command to execute in the container.", + Ref: ref("k8s.io/api/core/v1.ExecAction"), + }, + }, + "httpGet": { + SchemaProps: spec.SchemaProps{ + Description: "HTTPGet specifies an HTTP GET request to perform.", + Ref: ref("k8s.io/api/core/v1.HTTPGetAction"), + }, + }, + "tcpSocket": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated. TCPSocket is NOT supported as a LifecycleHandler and kept for backward compatibility. There is no validation of this field and lifecycle hooks will fail at runtime when it is specified.", + Ref: ref("k8s.io/api/core/v1.TCPSocketAction"), + }, + }, + "sleep": { + SchemaProps: spec.SchemaProps{ + Description: "Sleep represents a duration that the container should sleep.", + Ref: ref("k8s.io/api/core/v1.SleepAction"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ExecAction", "k8s.io/api/core/v1.HTTPGetAction", "k8s.io/api/core/v1.SleepAction", "k8s.io/api/core/v1.TCPSocketAction"}, + } +} + +func schema_k8sio_api_core_v1_LimitRange(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LimitRange sets resource usage limits for each kind of resource in a Namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the limits enforced. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LimitRangeSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LimitRangeSpec", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_LimitRangeItem(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LimitRangeItem defines a min/max usage limit for any resource that matches on kind.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of resource that this limit applies to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "max": { + SchemaProps: spec.SchemaProps{ + Description: "Max usage constraints on this kind by resource name.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "min": { + SchemaProps: spec.SchemaProps{ + Description: "Min usage constraints on this kind by resource name.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "default": { + SchemaProps: spec.SchemaProps{ + Description: "Default resource requirement limit value by resource name if resource limit is omitted.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "defaultRequest": { + SchemaProps: spec.SchemaProps{ + Description: "DefaultRequest is the default resource requirement request value by resource name if resource request is omitted.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "maxLimitRequestRatio": { + SchemaProps: spec.SchemaProps{ + Description: "MaxLimitRequestRatio if specified, the named resource must have a request and limit that are both non-zero where limit divided by request is less than or equal to the enumerated value; this represents the max burst for the named resource.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + }, + Required: []string{"type"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_LimitRangeList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LimitRangeList is a list of LimitRange items.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "Items is a list of LimitRange objects. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LimitRange"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LimitRange", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_LimitRangeSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LimitRangeSpec defines a min/max usage limit for resources that match on kind.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "limits": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Limits is the list of LimitRangeItem objects that are enforced.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LimitRangeItem"), + }, + }, + }, + }, + }, + }, + Required: []string{"limits"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LimitRangeItem"}, + } +} + +func schema_k8sio_api_core_v1_LinuxContainerUser(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LinuxContainerUser represents user identity information in Linux containers", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID is the primary uid initially attached to the first process in the container", + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + "gid": { + SchemaProps: spec.SchemaProps{ + Description: "GID is the primary gid initially attached to the first process in the container", + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + "supplementalGroups": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "SupplementalGroups are the supplemental groups initially attached to the first process in the container", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + }, + Required: []string{"uid", "gid"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_List(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "List holds a list of objects, which may not be known by the server.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of objects", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_k8sio_api_core_v1_LoadBalancerIngress(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LoadBalancerIngress represents the status of a load-balancer ingress point: traffic intended for the service should be sent to an ingress point.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ip": { + SchemaProps: spec.SchemaProps{ + Description: "IP is set for load-balancer ingress points that are IP based (typically GCE or OpenStack load-balancers)", + Type: []string{"string"}, + Format: "", + }, + }, + "hostname": { + SchemaProps: spec.SchemaProps{ + Description: "Hostname is set for load-balancer ingress points that are DNS based (typically AWS load-balancers)", + Type: []string{"string"}, + Format: "", + }, + }, + "ipMode": { + SchemaProps: spec.SchemaProps{ + Description: "IPMode specifies how the load-balancer IP behaves, and may only be specified when the ip field is specified. Setting this to \"VIP\" indicates that traffic is delivered to the node with the destination set to the load-balancer's IP and port. Setting this to \"Proxy\" indicates that traffic is delivered to the node or pod with the destination set to the node's IP and node port or the pod's IP and port. Service implementations may use this information to adjust traffic routing.", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Ports is a list of records of service ports If used, every port defined in the service should have an entry in it", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PortStatus"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PortStatus"}, + } +} + +func schema_k8sio_api_core_v1_LoadBalancerStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LoadBalancerStatus represents the status of a load-balancer.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ingress": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Ingress is a list containing ingress points for the load-balancer. Traffic intended for the service should be sent to these ingress points.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LoadBalancerIngress"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LoadBalancerIngress"}, + } +} + +func schema_k8sio_api_core_v1_LocalObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "LocalObjectReference contains enough information to let you locate the referenced object inside the same namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_LocalVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Local represents directly-attached storage with node affinity", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path of the full path to the volume on the node. It can be either a directory or block device (disk, partition, ...).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. It applies only when the Path is a block device. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". The default value is to auto-select a filesystem if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ModifyVolumeStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ModifyVolumeStatus represents the status object of ControllerModifyVolume operation", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "targetVolumeAttributesClassName": { + SchemaProps: spec.SchemaProps{ + Description: "targetVolumeAttributesClassName is the name of the VolumeAttributesClass the PVC currently being reconciled", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "status is the status of the ControllerModifyVolume operation. It can be in any of following states:\n - Pending\n Pending indicates that the PersistentVolumeClaim cannot be modified due to unmet requirements, such as\n the specified VolumeAttributesClass not existing.\n - InProgress\n InProgress indicates that the volume is being modified.\n - Infeasible\n Infeasible indicates that the request has been rejected as invalid by the CSI driver. To\n\t resolve the error, a valid VolumeAttributesClass needs to be specified.\nNote: New statuses can be added in the future. Consumers should check for unknown statuses and fail appropriately.\n\nPossible enum values:\n - `\"InProgress\"` InProgress indicates that the volume is being modified\n - `\"Infeasible\"` Infeasible indicates that the request has been rejected as invalid by the CSI driver. To resolve the error, a valid VolumeAttributesClass needs to be specified\n - `\"Pending\"` Pending indicates that the PersistentVolumeClaim cannot be modified due to unmet requirements, such as the specified VolumeAttributesClass not existing", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"InProgress", "Infeasible", "Pending"}, + }, + }, + }, + Required: []string{"status"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NFSVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents an NFS mount that lasts the lifetime of a pod. NFS volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "server": { + SchemaProps: spec.SchemaProps{ + Description: "server is the hostname or IP address of the NFS server. More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path that is exported by the NFS server. More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the NFS export to be mounted with read-only permissions. Defaults to false. More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"server", "path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Namespace(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Namespace provides a scope for Names. Use of multiple namespaces is optional.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the behavior of the Namespace. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NamespaceSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status describes the current status of a Namespace. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NamespaceStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NamespaceSpec", "k8s.io/api/core/v1.NamespaceStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_NamespaceCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NamespaceCondition contains details about state of namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of namespace controller condition.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time the condition transitioned from one status to another.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "Unique, one-word, CamelCase reason for the condition's last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Human-readable message indicating details about last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_NamespaceList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NamespaceList is a list of Namespaces.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "Items is the list of Namespace objects in the list. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Namespace"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Namespace", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_NamespaceSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NamespaceSpec describes the attributes on a Namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "finalizers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Finalizers is an opaque list of values that must be empty to permanently remove object from storage. More info: https://kubernetes.io/docs/tasks/administer-cluster/namespaces/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NamespaceStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NamespaceStatus is information about the current status of a Namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "phase": { + SchemaProps: spec.SchemaProps{ + Description: "Phase is the current lifecycle phase of the namespace. More info: https://kubernetes.io/docs/tasks/administer-cluster/namespaces/\n\nPossible enum values:\n - `\"Active\"` means the namespace is available for use in the system\n - `\"Terminating\"` means the namespace is undergoing graceful termination", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Active", "Terminating"}, + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Represents the latest available observations of a namespace's current state.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NamespaceCondition"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NamespaceCondition"}, + } +} + +func schema_k8sio_api_core_v1_Node(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Node is a worker node in Kubernetes. Each node will have a unique identifier in the cache (i.e. in etcd).", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the behavior of a node. https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Most recently observed status of the node. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSpec", "k8s.io/api/core/v1.NodeStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_NodeAddress(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeAddress contains information for the node's address.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Node address type, one of Hostname, ExternalIP or InternalIP.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "address": { + SchemaProps: spec.SchemaProps{ + Description: "The node address.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "address"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeAffinity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Node affinity is a group of node affinity scheduling rules.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "requiredDuringSchedulingIgnoredDuringExecution": { + SchemaProps: spec.SchemaProps{ + Description: "If the affinity requirements specified by this field are not met at scheduling time, the pod will not be scheduled onto the node. If the affinity requirements specified by this field cease to be met at some point during pod execution (e.g. due to an update), the system may or may not try to eventually evict the pod from its node.", + Ref: ref("k8s.io/api/core/v1.NodeSelector"), + }, + }, + "preferredDuringSchedulingIgnoredDuringExecution": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The scheduler will prefer to schedule pods to nodes that satisfy the affinity expressions specified by this field, but it may choose a node that violates one or more of the expressions. The node that is most preferred is the one with the greatest sum of weights, i.e. for each node that meets all of the scheduling requirements (resource request, requiredDuringScheduling affinity expressions, etc.), compute a sum by iterating through the elements of this field and adding \"weight\" to the sum if the node matches the corresponding matchExpressions; the node(s) with the highest sum are the most preferred.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PreferredSchedulingTerm"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSelector", "k8s.io/api/core/v1.PreferredSchedulingTerm"}, + } +} + +func schema_k8sio_api_core_v1_NodeCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeCondition contains condition information for a node.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of node condition.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lastHeartbeatTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time we got an update on a given condition.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time the condition transit from one status to another.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "(brief) reason for the condition's last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Human readable message indicating details about last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_NodeConfigSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeConfigSource specifies a source of node configuration. Exactly one subfield (excluding metadata) must be non-nil. This API is deprecated since 1.22", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "ConfigMap is a reference to a Node's ConfigMap", + Ref: ref("k8s.io/api/core/v1.ConfigMapNodeConfigSource"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ConfigMapNodeConfigSource"}, + } +} + +func schema_k8sio_api_core_v1_NodeConfigStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeConfigStatus describes the status of the config assigned by Node.Spec.ConfigSource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "assigned": { + SchemaProps: spec.SchemaProps{ + Description: "Assigned reports the checkpointed config the node will try to use. When Node.Spec.ConfigSource is updated, the node checkpoints the associated config payload to local disk, along with a record indicating intended config. The node refers to this record to choose its config checkpoint, and reports this record in Assigned. Assigned only updates in the status after the record has been checkpointed to disk. When the Kubelet is restarted, it tries to make the Assigned config the Active config by loading and validating the checkpointed payload identified by Assigned.", + Ref: ref("k8s.io/api/core/v1.NodeConfigSource"), + }, + }, + "active": { + SchemaProps: spec.SchemaProps{ + Description: "Active reports the checkpointed config the node is actively using. Active will represent either the current version of the Assigned config, or the current LastKnownGood config, depending on whether attempting to use the Assigned config results in an error.", + Ref: ref("k8s.io/api/core/v1.NodeConfigSource"), + }, + }, + "lastKnownGood": { + SchemaProps: spec.SchemaProps{ + Description: "LastKnownGood reports the checkpointed config the node will fall back to when it encounters an error attempting to use the Assigned config. The Assigned config becomes the LastKnownGood config when the node determines that the Assigned config is stable and correct. This is currently implemented as a 10-minute soak period starting when the local record of Assigned config is updated. If the Assigned config is Active at the end of this period, it becomes the LastKnownGood. Note that if Spec.ConfigSource is reset to nil (use local defaults), the LastKnownGood is also immediately reset to nil, because the local default config is always assumed good. You should not make assumptions about the node's method of determining config stability and correctness, as this may change or become configurable in the future.", + Ref: ref("k8s.io/api/core/v1.NodeConfigSource"), + }, + }, + "error": { + SchemaProps: spec.SchemaProps{ + Description: "Error describes any problems reconciling the Spec.ConfigSource to the Active config. Errors may occur, for example, attempting to checkpoint Spec.ConfigSource to the local Assigned record, attempting to checkpoint the payload associated with Spec.ConfigSource, attempting to load or validate the Assigned config, etc. Errors may occur at different points while syncing config. Earlier errors (e.g. download or checkpointing errors) will not result in a rollback to LastKnownGood, and may resolve across Kubelet retries. Later errors (e.g. loading or validating a checkpointed config) will result in a rollback to LastKnownGood. In the latter case, it is usually possible to resolve the error by fixing the config assigned in Spec.ConfigSource. You can find additional information for debugging by searching the error message in the Kubelet log. Error is a human-readable description of the error state; machines can check whether or not Error is empty, but should not rely on the stability of the Error text across Kubelet versions.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeConfigSource"}, + } +} + +func schema_k8sio_api_core_v1_NodeDaemonEndpoints(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeDaemonEndpoints lists ports opened by daemons running on the Node.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kubeletEndpoint": { + SchemaProps: spec.SchemaProps{ + Description: "Endpoint on which Kubelet is listening.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.DaemonEndpoint"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.DaemonEndpoint"}, + } +} + +func schema_k8sio_api_core_v1_NodeFeatures(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeFeatures describes the set of features implemented by the CRI implementation. The features contained in the NodeFeatures should depend only on the cri implementation independent of runtime handlers.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "supplementalGroupsPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "SupplementalGroupsPolicy is set to true if the runtime supports SupplementalGroupsPolicy and ContainerUser.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeList is the whole list of all Nodes which have been registered with master.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of nodes", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Node"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Node", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_NodeProxyOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeProxyOptions is the query options to a Node's proxy call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Path is the URL path to use for the current proxy request to node.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeRuntimeHandler(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeRuntimeHandler is a set of runtime handler information.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Runtime handler name. Empty for the default runtime handler.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "features": { + SchemaProps: spec.SchemaProps{ + Description: "Supported features.", + Ref: ref("k8s.io/api/core/v1.NodeRuntimeHandlerFeatures"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeRuntimeHandlerFeatures"}, + } +} + +func schema_k8sio_api_core_v1_NodeRuntimeHandlerFeatures(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeRuntimeHandlerFeatures is a set of features implemented by the runtime handler.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "recursiveReadOnlyMounts": { + SchemaProps: spec.SchemaProps{ + Description: "RecursiveReadOnlyMounts is set to true if the runtime handler supports RecursiveReadOnlyMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "userNamespaces": { + SchemaProps: spec.SchemaProps{ + Description: "UserNamespaces is set to true if the runtime handler supports UserNamespaces, including for volumes.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeSelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A node selector represents the union of the results of one or more label queries over a set of nodes; that is, it represents the OR of the selectors represented by the node selector terms.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "nodeSelectorTerms": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Required. A list of node selector terms. The terms are ORed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSelectorTerm"), + }, + }, + }, + }, + }, + }, + Required: []string{"nodeSelectorTerms"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSelectorTerm"}, + } +} + +func schema_k8sio_api_core_v1_NodeSelectorRequirement(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A node selector requirement is a selector that contains values, a key, and an operator that relates the key and values.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "The label key that the selector applies to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "Represents a key's relationship to a set of values. Valid operators are In, NotIn, Exists, DoesNotExist. Gt, and Lt.\n\nPossible enum values:\n - `\"DoesNotExist\"`\n - `\"Exists\"`\n - `\"Gt\"`\n - `\"In\"`\n - `\"Lt\"`\n - `\"NotIn\"`", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"DoesNotExist", "Exists", "Gt", "In", "Lt", "NotIn"}, + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "An array of string values. If the operator is In or NotIn, the values array must be non-empty. If the operator is Exists or DoesNotExist, the values array must be empty. If the operator is Gt or Lt, the values array must have a single element, which will be interpreted as an integer. This array is replaced during a strategic merge patch.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"key", "operator"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeSelectorTerm(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A null or empty node selector term matches no objects. The requirements of them are ANDed. The TopologySelectorTerm type implements a subset of the NodeSelectorTerm.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "matchExpressions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of node selector requirements by node's labels.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSelectorRequirement"), + }, + }, + }, + }, + }, + "matchFields": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of node selector requirements by node's fields.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSelectorRequirement"), + }, + }, + }, + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSelectorRequirement"}, + } +} + +func schema_k8sio_api_core_v1_NodeSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeSpec describes the attributes that a node is created with.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "podCIDR": { + SchemaProps: spec.SchemaProps{ + Description: "PodCIDR represents the pod IP range assigned to the node.", + Type: []string{"string"}, + Format: "", + }, + }, + "podCIDRs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "set", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "podCIDRs represents the IP ranges assigned to the node for usage by Pods on that node. If this field is specified, the 0th entry must match the podCIDR field. It may contain at most 1 value for each of IPv4 and IPv6.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "providerID": { + SchemaProps: spec.SchemaProps{ + Description: "ID of the node assigned by the cloud provider in the format: ://", + Type: []string{"string"}, + Format: "", + }, + }, + "unschedulable": { + SchemaProps: spec.SchemaProps{ + Description: "Unschedulable controls node schedulability of new pods. By default, node is schedulable. More info: https://kubernetes.io/docs/concepts/nodes/node/#manual-node-administration", + Type: []string{"boolean"}, + Format: "", + }, + }, + "taints": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If specified, the node's taints.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Taint"), + }, + }, + }, + }, + }, + "configSource": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated: Previously used to specify the source of the node's configuration for the DynamicKubeletConfig feature. This feature is removed.", + Ref: ref("k8s.io/api/core/v1.NodeConfigSource"), + }, + }, + "externalID": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated. Not all kubelets will set this field. Remove field after 1.13. see: https://issues.k8s.io/61966", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeConfigSource", "k8s.io/api/core/v1.Taint"}, + } +} + +func schema_k8sio_api_core_v1_NodeStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeStatus is information about the current status of a node.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "capacity": { + SchemaProps: spec.SchemaProps{ + Description: "Capacity represents the total resources of a node. More info: https://kubernetes.io/docs/reference/node/node-status/#capacity", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "allocatable": { + SchemaProps: spec.SchemaProps{ + Description: "Allocatable represents the resources of a node that are available for scheduling. Defaults to Capacity.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "phase": { + SchemaProps: spec.SchemaProps{ + Description: "NodePhase is the recently observed lifecycle phase of the node. More info: https://kubernetes.io/docs/concepts/nodes/node/#phase The field is never populated, and now is deprecated.\n\nPossible enum values:\n - `\"Pending\"` means the node has been created/added by the system, but not configured.\n - `\"Running\"` means the node has been configured and has Kubernetes components running.\n - `\"Terminated\"` means the node has been removed from the cluster.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Pending", "Running", "Terminated"}, + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Conditions is an array of current observed node conditions. More info: https://kubernetes.io/docs/reference/node/node-status/#condition", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeCondition"), + }, + }, + }, + }, + }, + "addresses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of addresses reachable to the node. Queried from cloud provider, if available. More info: https://kubernetes.io/docs/reference/node/node-status/#addresses Note: This field is declared as mergeable, but the merge key is not sufficiently unique, which can cause data corruption when it is merged. Callers should instead use a full-replacement patch. See https://pr.k8s.io/79391 for an example. Consumers should assume that addresses can change during the lifetime of a Node. However, there are some exceptions where this may not be possible, such as Pods that inherit a Node's address in its own status or consumers of the downward API (status.hostIP).", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeAddress"), + }, + }, + }, + }, + }, + "daemonEndpoints": { + SchemaProps: spec.SchemaProps{ + Description: "Endpoints of daemons running on the Node.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeDaemonEndpoints"), + }, + }, + "nodeInfo": { + SchemaProps: spec.SchemaProps{ + Description: "Set of ids/uuids to uniquely identify the node. More info: https://kubernetes.io/docs/reference/node/node-status/#info", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSystemInfo"), + }, + }, + "images": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of container images on this node", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerImage"), + }, + }, + }, + }, + }, + "volumesInUse": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of attachable volumes in use (mounted) by the node.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "volumesAttached": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of volumes that are attached to the node.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.AttachedVolume"), + }, + }, + }, + }, + }, + "config": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the config assigned to the node via the dynamic Kubelet config feature.", + Ref: ref("k8s.io/api/core/v1.NodeConfigStatus"), + }, + }, + "runtimeHandlers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The available runtime handlers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeRuntimeHandler"), + }, + }, + }, + }, + }, + "features": { + SchemaProps: spec.SchemaProps{ + Description: "Features describes the set of features implemented by the CRI implementation.", + Ref: ref("k8s.io/api/core/v1.NodeFeatures"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AttachedVolume", "k8s.io/api/core/v1.ContainerImage", "k8s.io/api/core/v1.NodeAddress", "k8s.io/api/core/v1.NodeCondition", "k8s.io/api/core/v1.NodeConfigStatus", "k8s.io/api/core/v1.NodeDaemonEndpoints", "k8s.io/api/core/v1.NodeFeatures", "k8s.io/api/core/v1.NodeRuntimeHandler", "k8s.io/api/core/v1.NodeSystemInfo", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_NodeSwapStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeSwapStatus represents swap memory information.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "capacity": { + SchemaProps: spec.SchemaProps{ + Description: "Total amount of swap memory in bytes.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_NodeSystemInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "NodeSystemInfo is a set of ids/uuids to uniquely identify the node.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "machineID": { + SchemaProps: spec.SchemaProps{ + Description: "MachineID reported by the node. For unique machine identification in the cluster this field is preferred. Learn more from man(5) machine-id: http://man7.org/linux/man-pages/man5/machine-id.5.html", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "systemUUID": { + SchemaProps: spec.SchemaProps{ + Description: "SystemUUID reported by the node. For unique machine identification MachineID is preferred. This field is specific to Red Hat hosts https://access.redhat.com/documentation/en-us/red_hat_subscription_management/1/html/rhsm/uuid", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "bootID": { + SchemaProps: spec.SchemaProps{ + Description: "Boot ID reported by the node.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kernelVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Kernel Version reported by the node from 'uname -r' (e.g. 3.16.0-0.bpo.4-amd64).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "osImage": { + SchemaProps: spec.SchemaProps{ + Description: "OS Image reported by the node from /etc/os-release (e.g. Debian GNU/Linux 7 (wheezy)).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "containerRuntimeVersion": { + SchemaProps: spec.SchemaProps{ + Description: "ContainerRuntime Version reported by the node through runtime remote API (e.g. containerd://1.4.2).", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kubeletVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Kubelet Version reported by the node.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kubeProxyVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated: KubeProxy Version reported by the node.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "operatingSystem": { + SchemaProps: spec.SchemaProps{ + Description: "The Operating System reported by the node", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "architecture": { + SchemaProps: spec.SchemaProps{ + Description: "The Architecture reported by the node", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "swap": { + SchemaProps: spec.SchemaProps{ + Description: "Swap Info reported by the node.", + Ref: ref("k8s.io/api/core/v1.NodeSwapStatus"), + }, + }, + }, + Required: []string{"machineID", "systemUUID", "bootID", "kernelVersion", "osImage", "containerRuntimeVersion", "kubeletVersion", "kubeProxyVersion", "operatingSystem", "architecture"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSwapStatus"}, + } +} + +func schema_k8sio_api_core_v1_ObjectFieldSelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectFieldSelector selects an APIVersioned field of an object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Version of the schema the FieldPath is written in terms of, defaults to \"v1\".", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldPath": { + SchemaProps: spec.SchemaProps{ + Description: "Path of the field to select in the specified API version.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"fieldPath"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectReference contains enough information to let you inspect or modify the referred object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind of the referent. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Type: []string{"string"}, + Format: "", + }, + }, + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#uids", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "API version of the referent.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Specific resourceVersion to which this reference is made, if any. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#concurrency-control-and-consistency", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldPath": { + SchemaProps: spec.SchemaProps{ + Description: "If referring to a piece of an object instead of an entire object, this string should contain a valid JSON/Go field access statement, such as desiredState.manifest.containers[2]. For example, if the object reference is to a container within a pod, this would take on a value like: \"spec.containers{name}\" (where \"name\" refers to the name of the container that triggered the event) or if no container name is specified \"spec.containers[2]\" (container with index 2 in this pod). This syntax is chosen only to have some well-defined way of referencing a part of an object.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PersistentVolume(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolume (PV) is a storage resource provisioned by an administrator. It is analogous to a node. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "spec defines a specification of a persistent volume owned by the cluster. Provisioned by an administrator. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistent-volumes", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "status represents the current information/status for the persistent volume. Populated by the system. Read-only. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistent-volumes", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeSpec", "k8s.io/api/core/v1.PersistentVolumeStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaim(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaim is a user's request for and claim to a persistent volume", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "spec defines the desired characteristics of a volume requested by a pod author. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "status represents the current information/status of a persistent volume claim. Read-only. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaimSpec", "k8s.io/api/core/v1.PersistentVolumeClaimStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimCondition contains details about state of pvc", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type is the type of the condition. More info: https://kubernetes.io/docs/reference/kubernetes-api/config-and-storage-resources/persistent-volume-claim-v1/#:~:text=set%20to%20%27ResizeStarted%27.-,PersistentVolumeClaimCondition,-contains%20details%20about", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status is the status of the condition. Can be True, False, Unknown. More info: https://kubernetes.io/docs/reference/kubernetes-api/config-and-storage-resources/persistent-volume-claim-v1/#:~:text=state%20of%20pvc-,conditions.status,-(string)%2C%20required", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lastProbeTime": { + SchemaProps: spec.SchemaProps{ + Description: "lastProbeTime is the time we probed the condition.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "lastTransitionTime is the time the condition transitioned from one status to another.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "reason is a unique, this should be a short, machine understandable string that gives the reason for condition's last transition. If it reports \"Resizing\" that means the underlying persistent volume is being resized.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "message is the human-readable message indicating details about last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimList is a list of PersistentVolumeClaim items.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "items is a list of persistent volume claims. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaim"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaim", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimSpec describes the common attributes of storage devices and allows a Source for provider-specific attributes", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "accessModes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "accessModes contains the desired access modes the volume should have. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#access-modes-1", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, + }, + }, + }, + }, + }, + "selector": { + SchemaProps: spec.SchemaProps{ + Description: "selector is a label query over volumes to consider for binding.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"), + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "resources represents the minimum resources the volume should have. If RecoverVolumeExpansionFailure feature is enabled users are allowed to specify resource requirements that are lower than previous value but must still be higher than capacity recorded in the status field of the claim. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#resources", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeResourceRequirements"), + }, + }, + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeName is the binding reference to the PersistentVolume backing this claim.", + Type: []string{"string"}, + Format: "", + }, + }, + "storageClassName": { + SchemaProps: spec.SchemaProps{ + Description: "storageClassName is the name of the StorageClass required by the claim. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#class-1", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeMode": { + SchemaProps: spec.SchemaProps{ + Description: "volumeMode defines what type of volume is required by the claim. Value of Filesystem is implied when not included in claim spec.\n\nPossible enum values:\n - `\"Block\"` means the volume will not be formatted with a filesystem and will remain a raw block device.\n - `\"Filesystem\"` means the volume will be or is formatted with a filesystem.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Block", "Filesystem"}, + }, + }, + "dataSource": { + SchemaProps: spec.SchemaProps{ + Description: "dataSource field can be used to specify either: * An existing VolumeSnapshot object (snapshot.storage.k8s.io/VolumeSnapshot) * An existing PVC (PersistentVolumeClaim) If the provisioner or an external controller can support the specified data source, it will create a new volume based on the contents of the specified data source. When the AnyVolumeDataSource feature gate is enabled, dataSource contents will be copied to dataSourceRef, and dataSourceRef contents will be copied to dataSource when dataSourceRef.namespace is not specified. If the namespace is specified, then dataSourceRef will not be copied to dataSource.", + Ref: ref("k8s.io/api/core/v1.TypedLocalObjectReference"), + }, + }, + "dataSourceRef": { + SchemaProps: spec.SchemaProps{ + Description: "dataSourceRef specifies the object from which to populate the volume with data, if a non-empty volume is desired. This may be any object from a non-empty API group (non core object) or a PersistentVolumeClaim object. When this field is specified, volume binding will only succeed if the type of the specified object matches some installed volume populator or dynamic provisioner. This field will replace the functionality of the dataSource field and as such if both fields are non-empty, they must have the same value. For backwards compatibility, when namespace isn't specified in dataSourceRef, both fields (dataSource and dataSourceRef) will be set to the same value automatically if one of them is empty and the other is non-empty. When namespace is specified in dataSourceRef, dataSource isn't set to the same value and must be empty. There are three important differences between dataSource and dataSourceRef: * While dataSource only allows two specific types of objects, dataSourceRef\n allows any non-core object, as well as PersistentVolumeClaim objects.\n* While dataSource ignores disallowed values (dropping them), dataSourceRef\n preserves all values, and generates an error if a disallowed value is\n specified.\n* While dataSource only allows local objects, dataSourceRef allows objects\n in any namespaces.\n(Beta) Using this field requires the AnyVolumeDataSource feature gate to be enabled. (Alpha) Using the namespace field of dataSourceRef requires the CrossNamespaceVolumeDataSource feature gate to be enabled.", + Ref: ref("k8s.io/api/core/v1.TypedObjectReference"), + }, + }, + "volumeAttributesClassName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeAttributesClassName may be used to set the VolumeAttributesClass used by this claim. If specified, the CSI driver will create or update the volume with the attributes defined in the corresponding VolumeAttributesClass. This has a different purpose than storageClassName, it can be changed after the claim is created. An empty string or nil value indicates that no VolumeAttributesClass will be applied to the claim. If the claim enters an Infeasible error state, this field can be reset to its previous value (including nil) to cancel the modification. If the resource referred to by volumeAttributesClass does not exist, this PersistentVolumeClaim will be set to a Pending state, as reflected by the modifyVolumeStatus field, until such as a resource exists. More info: https://kubernetes.io/docs/concepts/storage/volume-attributes-classes/", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.TypedLocalObjectReference", "k8s.io/api/core/v1.TypedObjectReference", "k8s.io/api/core/v1.VolumeResourceRequirements", "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimStatus is the current status of a persistent volume claim.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "phase": { + SchemaProps: spec.SchemaProps{ + Description: "phase represents the current phase of PersistentVolumeClaim.\n\nPossible enum values:\n - `\"Bound\"` used for PersistentVolumeClaims that are bound\n - `\"Lost\"` used for PersistentVolumeClaims that lost their underlying PersistentVolume. The claim was bound to a PersistentVolume and this volume does not exist any longer and all data on it was lost.\n - `\"Pending\"` used for PersistentVolumeClaims that are not yet bound", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Bound", "Lost", "Pending"}, + }, + }, + "accessModes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "accessModes contains the actual access modes the volume backing the PVC has. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#access-modes-1", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, + }, + }, + }, + }, + }, + "capacity": { + SchemaProps: spec.SchemaProps{ + Description: "capacity represents the actual resources of the underlying volume.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "conditions is the current Condition of persistent volume claim. If underlying persistent volume is being resized then the Condition will be set to 'Resizing'.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimCondition"), + }, + }, + }, + }, + }, + "allocatedResources": { + SchemaProps: spec.SchemaProps{ + Description: "allocatedResources tracks the resources allocated to a PVC including its capacity. Key names follow standard Kubernetes label syntax. Valid values are either:\n\t* Un-prefixed keys:\n\t\t- storage - the capacity of the volume.\n\t* Custom resources must use implementation-defined prefixed names such as \"example.com/my-custom-resource\"\nApart from above values - keys that are unprefixed or have kubernetes.io prefix are considered reserved and hence may not be used.\n\nCapacity reported here may be larger than the actual capacity when a volume expansion operation is requested. For storage quota, the larger value from allocatedResources and PVC.spec.resources is used. If allocatedResources is not set, PVC.spec.resources alone is used for quota calculation. If a volume expansion capacity request is lowered, allocatedResources is only lowered if there are no expansion operations in progress and if the actual volume capacity is equal or lower than the requested capacity.\n\nA controller that receives PVC update with previously unknown resourceName should ignore the update for the purpose it was designed. For example - a controller that only is responsible for resizing capacity of the volume, should ignore PVC updates that change other valid resources associated with PVC.\n\nThis is an alpha field and requires enabling RecoverVolumeExpansionFailure feature.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "allocatedResourceStatuses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "granular", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "allocatedResourceStatuses stores status of resource being resized for the given PVC. Key names follow standard Kubernetes label syntax. Valid values are either:\n\t* Un-prefixed keys:\n\t\t- storage - the capacity of the volume.\n\t* Custom resources must use implementation-defined prefixed names such as \"example.com/my-custom-resource\"\nApart from above values - keys that are unprefixed or have kubernetes.io prefix are considered reserved and hence may not be used.\n\nClaimResourceStatus can be in any of following states:\n\t- ControllerResizeInProgress:\n\t\tState set when resize controller starts resizing the volume in control-plane.\n\t- ControllerResizeFailed:\n\t\tState set when resize has failed in resize controller with a terminal error.\n\t- NodeResizePending:\n\t\tState set when resize controller has finished resizing the volume but further resizing of\n\t\tvolume is needed on the node.\n\t- NodeResizeInProgress:\n\t\tState set when kubelet starts resizing the volume.\n\t- NodeResizeFailed:\n\t\tState set when resizing has failed in kubelet with a terminal error. Transient errors don't set\n\t\tNodeResizeFailed.\nFor example: if expanding a PVC for more capacity - this field can be one of the following states:\n\t- pvc.status.allocatedResourceStatus['storage'] = \"ControllerResizeInProgress\"\n - pvc.status.allocatedResourceStatus['storage'] = \"ControllerResizeFailed\"\n - pvc.status.allocatedResourceStatus['storage'] = \"NodeResizePending\"\n - pvc.status.allocatedResourceStatus['storage'] = \"NodeResizeInProgress\"\n - pvc.status.allocatedResourceStatus['storage'] = \"NodeResizeFailed\"\nWhen this field is not set, it means that no resize operation is in progress for the given PVC.\n\nA controller that receives PVC update with previously unknown resourceName or ClaimResourceStatus should ignore the update for the purpose it was designed. For example - a controller that only is responsible for resizing capacity of the volume, should ignore PVC updates that change other valid resources associated with PVC.\n\nThis is an alpha field and requires enabling RecoverVolumeExpansionFailure feature.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, + }, + }, + }, + }, + }, + "currentVolumeAttributesClassName": { + SchemaProps: spec.SchemaProps{ + Description: "currentVolumeAttributesClassName is the current name of the VolumeAttributesClass the PVC is using. When unset, there is no VolumeAttributeClass applied to this PersistentVolumeClaim", + Type: []string{"string"}, + Format: "", + }, + }, + "modifyVolumeStatus": { + SchemaProps: spec.SchemaProps{ + Description: "ModifyVolumeStatus represents the status object of ControllerModifyVolume operation. When this is unset, there is no ModifyVolume operation being attempted.", + Ref: ref("k8s.io/api/core/v1.ModifyVolumeStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ModifyVolumeStatus", "k8s.io/api/core/v1.PersistentVolumeClaimCondition", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimTemplate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimTemplate is used to produce PersistentVolumeClaim objects as part of an EphemeralVolumeSource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "May contain labels and annotations that will be copied into the PVC when creating it. No other fields are allowed and will be rejected during validation.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "The specification for the PersistentVolumeClaim. The entire content is copied unchanged into the PVC that gets created from this template. The same fields as in a PersistentVolumeClaim are also valid here.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimSpec"), + }, + }, + }, + Required: []string{"spec"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaimSpec", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeClaimVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimVolumeSource references the user's PVC in the same namespace. This volume finds the bound PV and mounts that volume for the pod. A PersistentVolumeClaimVolumeSource is, essentially, a wrapper around another type of volume that is owned by someone else (the system).", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "claimName": { + SchemaProps: spec.SchemaProps{ + Description: "claimName is the name of a PersistentVolumeClaim in the same namespace as the pod using this volume. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly Will force the ReadOnly setting in VolumeMounts. Default false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"claimName"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeList is a list of PersistentVolume items.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "items is a list of persistent volumes. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolume"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolume", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeSource is similar to VolumeSource but meant for the administrator who creates PVs. Exactly one of its members must be set.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Provisioned by an admin. Deprecated: GCEPersistentDisk is deprecated. All operations for the in-tree gcePersistentDisk type are redirected to the pd.csi.storage.gke.io CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: AWSElasticBlockStore is deprecated. All operations for the in-tree awsElasticBlockStore type are redirected to the ebs.csi.aws.com CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a directory on the host. Provisioned by a developer or tester. This is useful for single-node development and testing only! On-host storage is not supported in any way and WILL NOT WORK in a multi-node cluster. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs volume that is attached to a host and exposed to the pod. Provisioned by an admin. Deprecated: Glusterfs is deprecated and the in-tree glusterfs type is no longer supported. More info: https://examples.k8s.io/volumes/glusterfs/README.md", + Ref: ref("k8s.io/api/core/v1.GlusterfsPersistentVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host. Provisioned by an admin. More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. Deprecated: RBD is deprecated and the in-tree rbd type is no longer supported. More info: https://examples.k8s.io/volumes/rbd/README.md", + Ref: ref("k8s.io/api/core/v1.RBDPersistentVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Provisioned by an admin.", + Ref: ref("k8s.io/api/core/v1.ISCSIPersistentVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. Deprecated: Cinder is deprecated. All operations for the in-tree cinder type are redirected to the cinder.csi.openstack.org CSI driver. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderPersistentVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime. Deprecated: CephFS is deprecated and the in-tree cephfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.CephFSPersistentVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine and exposed to the pod for its usage. This depends on the Flocker control service being running. Deprecated: Flocker is deprecated and the in-tree flocker type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin. Deprecated: FlexVolume is deprecated. Consider using a CSIDriver instead.", + Ref: ref("k8s.io/api/core/v1.FlexPersistentVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod. Deprecated: AzureFile is deprecated. All operations for the in-tree azureFile type are redirected to the file.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureFilePersistentVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine. Deprecated: VsphereVolume is deprecated. All operations for the in-tree vsphereVolume type are redirected to the csi.vsphere.vmware.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime. Deprecated: Quobyte is deprecated and the in-tree quobyte type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod. Deprecated: AzureDisk is deprecated. All operations for the in-tree azureDisk type are redirected to the disk.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine. Deprecated: PhotonPersistentDisk is deprecated and the in-tree photonPersistentDisk type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine. Deprecated: PortworxVolume is deprecated. All operations for the in-tree portworxVolume type are redirected to the pxd.portworx.com CSI driver when the CSIMigrationPortworx feature-gate is on.", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes. Deprecated: ScaleIO is deprecated and the in-tree scaleIO type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.ScaleIOPersistentVolumeSource"), + }, + }, + "local": { + SchemaProps: spec.SchemaProps{ + Description: "local represents directly-attached storage with node affinity", + Ref: ref("k8s.io/api/core/v1.LocalVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume that is attached to the kubelet's host machine and mounted into the pod. Deprecated: StorageOS is deprecated and the in-tree storageos type is no longer supported. More info: https://examples.k8s.io/volumes/storageos/README.md", + Ref: ref("k8s.io/api/core/v1.StorageOSPersistentVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi represents storage that is handled by an external CSI driver.", + Ref: ref("k8s.io/api/core/v1.CSIPersistentVolumeSource"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFilePersistentVolumeSource", "k8s.io/api/core/v1.CSIPersistentVolumeSource", "k8s.io/api/core/v1.CephFSPersistentVolumeSource", "k8s.io/api/core/v1.CinderPersistentVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexPersistentVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GlusterfsPersistentVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIPersistentVolumeSource", "k8s.io/api/core/v1.LocalVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDPersistentVolumeSource", "k8s.io/api/core/v1.ScaleIOPersistentVolumeSource", "k8s.io/api/core/v1.StorageOSPersistentVolumeSource", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeSpec is the specification of a persistent volume.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "capacity": { + SchemaProps: spec.SchemaProps{ + Description: "capacity is the description of the persistent volume's resources and capacity. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#capacity", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Provisioned by an admin. Deprecated: GCEPersistentDisk is deprecated. All operations for the in-tree gcePersistentDisk type are redirected to the pd.csi.storage.gke.io CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: AWSElasticBlockStore is deprecated. All operations for the in-tree awsElasticBlockStore type are redirected to the ebs.csi.aws.com CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a directory on the host. Provisioned by a developer or tester. This is useful for single-node development and testing only! On-host storage is not supported in any way and WILL NOT WORK in a multi-node cluster. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs volume that is attached to a host and exposed to the pod. Provisioned by an admin. Deprecated: Glusterfs is deprecated and the in-tree glusterfs type is no longer supported. More info: https://examples.k8s.io/volumes/glusterfs/README.md", + Ref: ref("k8s.io/api/core/v1.GlusterfsPersistentVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host. Provisioned by an admin. More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. Deprecated: RBD is deprecated and the in-tree rbd type is no longer supported. More info: https://examples.k8s.io/volumes/rbd/README.md", + Ref: ref("k8s.io/api/core/v1.RBDPersistentVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Provisioned by an admin.", + Ref: ref("k8s.io/api/core/v1.ISCSIPersistentVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. Deprecated: Cinder is deprecated. All operations for the in-tree cinder type are redirected to the cinder.csi.openstack.org CSI driver. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderPersistentVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime. Deprecated: CephFS is deprecated and the in-tree cephfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.CephFSPersistentVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine and exposed to the pod for its usage. This depends on the Flocker control service being running. Deprecated: Flocker is deprecated and the in-tree flocker type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin. Deprecated: FlexVolume is deprecated. Consider using a CSIDriver instead.", + Ref: ref("k8s.io/api/core/v1.FlexPersistentVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod. Deprecated: AzureFile is deprecated. All operations for the in-tree azureFile type are redirected to the file.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureFilePersistentVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine. Deprecated: VsphereVolume is deprecated. All operations for the in-tree vsphereVolume type are redirected to the csi.vsphere.vmware.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime. Deprecated: Quobyte is deprecated and the in-tree quobyte type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod. Deprecated: AzureDisk is deprecated. All operations for the in-tree azureDisk type are redirected to the disk.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine. Deprecated: PhotonPersistentDisk is deprecated and the in-tree photonPersistentDisk type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine. Deprecated: PortworxVolume is deprecated. All operations for the in-tree portworxVolume type are redirected to the pxd.portworx.com CSI driver when the CSIMigrationPortworx feature-gate is on.", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes. Deprecated: ScaleIO is deprecated and the in-tree scaleIO type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.ScaleIOPersistentVolumeSource"), + }, + }, + "local": { + SchemaProps: spec.SchemaProps{ + Description: "local represents directly-attached storage with node affinity", + Ref: ref("k8s.io/api/core/v1.LocalVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume that is attached to the kubelet's host machine and mounted into the pod. Deprecated: StorageOS is deprecated and the in-tree storageos type is no longer supported. More info: https://examples.k8s.io/volumes/storageos/README.md", + Ref: ref("k8s.io/api/core/v1.StorageOSPersistentVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi represents storage that is handled by an external CSI driver.", + Ref: ref("k8s.io/api/core/v1.CSIPersistentVolumeSource"), + }, + }, + "accessModes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "accessModes contains all ways the volume can be mounted. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#access-modes", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, + }, + }, + }, + }, + }, + "claimRef": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "granular", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "claimRef is part of a bi-directional binding between PersistentVolume and PersistentVolumeClaim. Expected to be non-nil when bound. claim.VolumeName is the authoritative bind between PV and PVC. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#binding", + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + "persistentVolumeReclaimPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "persistentVolumeReclaimPolicy defines what happens to a persistent volume when released from its claim. Valid options are Retain (default for manually created PersistentVolumes), Delete (default for dynamically provisioned PersistentVolumes), and Recycle (deprecated). Recycle must be supported by the volume plugin underlying this PersistentVolume. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#reclaiming\n\nPossible enum values:\n - `\"Delete\"` means the volume will be deleted from Kubernetes on release from its claim. The volume plugin must support Deletion.\n - `\"Recycle\"` means the volume will be recycled back into the pool of unbound persistent volumes on release from its claim. The volume plugin must support Recycling.\n - `\"Retain\"` means the volume will be left in its current phase (Released) for manual reclamation by the administrator. The default policy is Retain.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Delete", "Recycle", "Retain"}, + }, + }, + "storageClassName": { + SchemaProps: spec.SchemaProps{ + Description: "storageClassName is the name of StorageClass to which this persistent volume belongs. Empty value means that this volume does not belong to any StorageClass.", + Type: []string{"string"}, + Format: "", + }, + }, + "mountOptions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "mountOptions is the list of mount options, e.g. [\"ro\", \"soft\"]. Not validated - mount will simply fail if one is invalid. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes/#mount-options", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "volumeMode": { + SchemaProps: spec.SchemaProps{ + Description: "volumeMode defines if a volume is intended to be used with a formatted filesystem or to remain in raw block state. Value of Filesystem is implied when not included in spec.\n\nPossible enum values:\n - `\"Block\"` means the volume will not be formatted with a filesystem and will remain a raw block device.\n - `\"Filesystem\"` means the volume will be or is formatted with a filesystem.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Block", "Filesystem"}, + }, + }, + "nodeAffinity": { + SchemaProps: spec.SchemaProps{ + Description: "nodeAffinity defines constraints that limit what nodes this volume can be accessed from. This field influences the scheduling of pods that use this volume.", + Ref: ref("k8s.io/api/core/v1.VolumeNodeAffinity"), + }, + }, + "volumeAttributesClassName": { + SchemaProps: spec.SchemaProps{ + Description: "Name of VolumeAttributesClass to which this persistent volume belongs. Empty value is not allowed. When this field is not set, it indicates that this volume does not belong to any VolumeAttributesClass. This field is mutable and can be changed by the CSI driver after a volume has been updated successfully to a new class. For an unbound PersistentVolume, the volumeAttributesClassName will be matched with unbound PersistentVolumeClaims during the binding process.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFilePersistentVolumeSource", "k8s.io/api/core/v1.CSIPersistentVolumeSource", "k8s.io/api/core/v1.CephFSPersistentVolumeSource", "k8s.io/api/core/v1.CinderPersistentVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexPersistentVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GlusterfsPersistentVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIPersistentVolumeSource", "k8s.io/api/core/v1.LocalVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.ObjectReference", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDPersistentVolumeSource", "k8s.io/api/core/v1.ScaleIOPersistentVolumeSource", "k8s.io/api/core/v1.StorageOSPersistentVolumeSource", "k8s.io/api/core/v1.VolumeNodeAffinity", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_PersistentVolumeStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeStatus is the current status of a persistent volume.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "phase": { + SchemaProps: spec.SchemaProps{ + Description: "phase indicates if a volume is available, bound to a claim, or released by a claim. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#phase\n\nPossible enum values:\n - `\"Available\"` used for PersistentVolumes that are not yet bound Available volumes are held by the binder and matched to PersistentVolumeClaims\n - `\"Bound\"` used for PersistentVolumes that are bound\n - `\"Failed\"` used for PersistentVolumes that failed to be correctly recycled or deleted after being released from a claim\n - `\"Pending\"` used for PersistentVolumes that are not available\n - `\"Released\"` used for PersistentVolumes where the bound PersistentVolumeClaim was deleted released volumes must be recycled before becoming available again this phase is used by the persistent volume claim binder to signal to another process to reclaim the resource", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Available", "Bound", "Failed", "Pending", "Released"}, + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "message is a human-readable message indicating details about why the volume is in this state.", + Type: []string{"string"}, + Format: "", + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "reason is a brief CamelCase string that describes any failure and is meant for machine parsing and tidy display in the CLI.", + Type: []string{"string"}, + Format: "", + }, + }, + "lastPhaseTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "lastPhaseTransitionTime is the time the phase transitioned from one to another and automatically resets to current time everytime a volume phase transitions.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PhotonPersistentDiskVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Photon Controller persistent disk resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "pdID": { + SchemaProps: spec.SchemaProps{ + Description: "pdID is the ID that identifies Photon Controller persistent disk", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"pdID"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Pod(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Pod is a collection of containers that can run on a host. This resource is created by clients and scheduled onto hosts.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Specification of the desired behavior of the pod. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Most recently observed status of the pod. This data may not be up to date. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodSpec", "k8s.io/api/core/v1.PodStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PodAffinity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Pod affinity is a group of inter pod affinity scheduling rules.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "requiredDuringSchedulingIgnoredDuringExecution": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If the affinity requirements specified by this field are not met at scheduling time, the pod will not be scheduled onto the node. If the affinity requirements specified by this field cease to be met at some point during pod execution (e.g. due to a pod label update), the system may or may not try to eventually evict the pod from its node. When there are multiple elements, the lists of nodes corresponding to each podAffinityTerm are intersected, i.e. all terms must be satisfied.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodAffinityTerm"), + }, + }, + }, + }, + }, + "preferredDuringSchedulingIgnoredDuringExecution": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The scheduler will prefer to schedule pods to nodes that satisfy the affinity expressions specified by this field, but it may choose a node that violates one or more of the expressions. The node that is most preferred is the one with the greatest sum of weights, i.e. for each node that meets all of the scheduling requirements (resource request, requiredDuringScheduling affinity expressions, etc.), compute a sum by iterating through the elements of this field and adding \"weight\" to the sum if the node has pods which matches the corresponding podAffinityTerm; the node(s) with the highest sum are the most preferred.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.WeightedPodAffinityTerm"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodAffinityTerm", "k8s.io/api/core/v1.WeightedPodAffinityTerm"}, + } +} + +func schema_k8sio_api_core_v1_PodAffinityTerm(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Defines a set of pods (namely those matching the labelSelector relative to the given namespace(s)) that this pod should be co-located (affinity) or not co-located (anti-affinity) with, where co-located is defined as running on a node whose value of the label with key matches that of any node on which a pod of the set of pods is running", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "labelSelector": { + SchemaProps: spec.SchemaProps{ + Description: "A label query over a set of resources, in this case pods. If it's null, this PodAffinityTerm matches with no Pods.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"), + }, + }, + "namespaces": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "namespaces specifies a static list of namespace names that the term applies to. The term is applied to the union of the namespaces listed in this field and the ones selected by namespaceSelector. null or empty namespaces list and null namespaceSelector means \"this pod's namespace\".", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "topologyKey": { + SchemaProps: spec.SchemaProps{ + Description: "This pod should be co-located (affinity) or not co-located (anti-affinity) with the pods matching the labelSelector in the specified namespaces, where co-located is defined as running on a node whose value of the label with key topologyKey matches that of any node on which any of the selected pods is running. Empty topologyKey is not allowed.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespaceSelector": { + SchemaProps: spec.SchemaProps{ + Description: "A label query over the set of namespaces that the term applies to. The term is applied to the union of the namespaces selected by this field and the ones listed in the namespaces field. null selector and null or empty namespaces list means \"this pod's namespace\". An empty selector ({}) matches all namespaces.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"), + }, + }, + "matchLabelKeys": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "MatchLabelKeys is a set of pod label keys to select which pods will be taken into consideration. The keys are used to lookup values from the incoming pod labels, those key-value labels are merged with `labelSelector` as `key in (value)` to select the group of existing pods which pods will be taken into consideration for the incoming pod's pod (anti) affinity. Keys that don't exist in the incoming pod labels will be ignored. The default value is empty. The same key is forbidden to exist in both matchLabelKeys and labelSelector. Also, matchLabelKeys cannot be set when labelSelector isn't set.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "mismatchLabelKeys": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "MismatchLabelKeys is a set of pod label keys to select which pods will be taken into consideration. The keys are used to lookup values from the incoming pod labels, those key-value labels are merged with `labelSelector` as `key notin (value)` to select the group of existing pods which pods will be taken into consideration for the incoming pod's pod (anti) affinity. Keys that don't exist in the incoming pod labels will be ignored. The default value is empty. The same key is forbidden to exist in both mismatchLabelKeys and labelSelector. Also, mismatchLabelKeys cannot be set when labelSelector isn't set.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"topologyKey"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"}, + } +} + +func schema_k8sio_api_core_v1_PodAntiAffinity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Pod anti affinity is a group of inter pod anti affinity scheduling rules.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "requiredDuringSchedulingIgnoredDuringExecution": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If the anti-affinity requirements specified by this field are not met at scheduling time, the pod will not be scheduled onto the node. If the anti-affinity requirements specified by this field cease to be met at some point during pod execution (e.g. due to a pod label update), the system may or may not try to eventually evict the pod from its node. When there are multiple elements, the lists of nodes corresponding to each podAffinityTerm are intersected, i.e. all terms must be satisfied.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodAffinityTerm"), + }, + }, + }, + }, + }, + "preferredDuringSchedulingIgnoredDuringExecution": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The scheduler will prefer to schedule pods to nodes that satisfy the anti-affinity expressions specified by this field, but it may choose a node that violates one or more of the expressions. The node that is most preferred is the one with the greatest sum of weights, i.e. for each node that meets all of the scheduling requirements (resource request, requiredDuringScheduling anti-affinity expressions, etc.), compute a sum by iterating through the elements of this field and subtracting \"weight\" from the sum if the node has pods which matches the corresponding podAffinityTerm; the node(s) with the highest sum are the most preferred.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.WeightedPodAffinityTerm"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodAffinityTerm", "k8s.io/api/core/v1.WeightedPodAffinityTerm"}, + } +} + +func schema_k8sio_api_core_v1_PodAttachOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodAttachOptions is the query options to a Pod's remote attach call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "stdin": { + SchemaProps: spec.SchemaProps{ + Description: "Stdin if true, redirects the standard input stream of the pod for this call. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stdout": { + SchemaProps: spec.SchemaProps{ + Description: "Stdout if true indicates that stdout is to be redirected for the attach call. Defaults to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stderr": { + SchemaProps: spec.SchemaProps{ + Description: "Stderr if true indicates that stderr is to be redirected for the attach call. Defaults to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tty": { + SchemaProps: spec.SchemaProps{ + Description: "TTY if true indicates that a tty will be allocated for the attach call. This is passed through the container runtime so the tty is allocated on the worker node by the container runtime. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "container": { + SchemaProps: spec.SchemaProps{ + Description: "The container in which to execute the command. Defaults to only container if there is only one container in the pod.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodCertificateProjection provides a private key and X.509 certificate in the pod filesystem.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "signerName": { + SchemaProps: spec.SchemaProps{ + Description: "Kubelet's generated CSRs will be addressed to this signer.", + Type: []string{"string"}, + Format: "", + }, + }, + "keyType": { + SchemaProps: spec.SchemaProps{ + Description: "The type of keypair Kubelet will generate for the pod.\n\nValid values are \"RSA3072\", \"RSA4096\", \"ECDSAP256\", \"ECDSAP384\", \"ECDSAP521\", and \"ED25519\".", + Type: []string{"string"}, + Format: "", + }, + }, + "maxExpirationSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "maxExpirationSeconds is the maximum lifetime permitted for the certificate.\n\nKubelet copies this value verbatim into the PodCertificateRequests it generates for this projection.\n\nIf omitted, kube-apiserver will set it to 86400(24 hours). kube-apiserver will reject values shorter than 3600 (1 hour). The maximum allowable value is 7862400 (91 days).\n\nThe signer implementation is then free to issue a certificate with any lifetime *shorter* than MaxExpirationSeconds, but no shorter than 3600 seconds (1 hour). This constraint is enforced by kube-apiserver. `kubernetes.io` signers will never issue certificates with a lifetime longer than 24 hours.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "credentialBundlePath": { + SchemaProps: spec.SchemaProps{ + Description: "Write the credential bundle at this path in the projected volume.\n\nThe credential bundle is a single file that contains multiple PEM blocks. The first PEM block is a PRIVATE KEY block, containing a PKCS#8 private key.\n\nThe remaining blocks are CERTIFICATE blocks, containing the issued certificate chain from the signer (leaf and any intermediates).\n\nUsing credentialBundlePath lets your Pod's application code make a single atomic read that retrieves a consistent key and certificate chain. If you project them to separate files, your application code will need to additionally check that the leaf certificate was issued to the key.", + Type: []string{"string"}, + Format: "", + }, + }, + "keyPath": { + SchemaProps: spec.SchemaProps{ + Description: "Write the key at this path in the projected volume.\n\nMost applications should use credentialBundlePath. When using keyPath and certificateChainPath, your application needs to check that the key and leaf certificate are consistent, because it is possible to read the files mid-rotation.", + Type: []string{"string"}, + Format: "", + }, + }, + "certificateChainPath": { + SchemaProps: spec.SchemaProps{ + Description: "Write the certificate chain at this path in the projected volume.\n\nMost applications should use credentialBundlePath. When using keyPath and certificateChainPath, your application needs to check that the key and leaf certificate are consistent, because it is possible to read the files mid-rotation.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"signerName", "keyType"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodCondition contains details for the current condition of this pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type is the type of the condition. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-conditions", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "observedGeneration": { + SchemaProps: spec.SchemaProps{ + Description: "If set, this represents the .metadata.generation that the pod condition was set based upon. This is an alpha field. Enable PodObservedGenerationTracking to be able to use this field.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status is the status of the condition. Can be True, False, Unknown. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-conditions", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lastProbeTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time we probed the condition.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time the condition transitioned from one status to another.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "Unique, one-word, CamelCase reason for the condition's last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Human-readable message indicating details about last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PodDNSConfig(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodDNSConfig defines the DNS parameters of a pod in addition to those generated from DNSPolicy.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "nameservers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of DNS name server IP addresses. This will be appended to the base nameservers generated from DNSPolicy. Duplicated nameservers will be removed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "searches": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of DNS search domains for host-name lookup. This will be appended to the base search paths generated from DNSPolicy. Duplicated search paths will be removed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "options": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of DNS resolver options. This will be merged with the base options generated from DNSPolicy. Duplicated entries will be removed. Resolution options given in Options will override those that appear in the base DNSPolicy.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodDNSConfigOption"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodDNSConfigOption"}, + } +} + +func schema_k8sio_api_core_v1_PodDNSConfigOption(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodDNSConfigOption defines DNS resolver options of a pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is this DNS resolver option's name. Required.", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "Value is this DNS resolver option's value.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodExecOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodExecOptions is the query options to a Pod's remote exec call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "stdin": { + SchemaProps: spec.SchemaProps{ + Description: "Redirect the standard input stream of the pod for this call. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stdout": { + SchemaProps: spec.SchemaProps{ + Description: "Redirect the standard output stream of the pod for this call.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stderr": { + SchemaProps: spec.SchemaProps{ + Description: "Redirect the standard error stream of the pod for this call.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tty": { + SchemaProps: spec.SchemaProps{ + Description: "TTY if true indicates that a tty will be allocated for the exec call. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "container": { + SchemaProps: spec.SchemaProps{ + Description: "Container in which to execute the command. Defaults to only container if there is only one container in the pod.", + Type: []string{"string"}, + Format: "", + }, + }, + "command": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Command is the remote command to execute. argv array. Not executed within a shell.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"command"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodExtendedResourceClaimStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodExtendedResourceClaimStatus is stored in the PodStatus for the extended resource requests backed by DRA. It stores the generated name for the corresponding special ResourceClaim created by the scheduler.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "requestMappings": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "RequestMappings identifies the mapping of to device request in the generated ResourceClaim.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerExtendedResourceRequest"), + }, + }, + }, + }, + }, + "resourceClaimName": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaimName is the name of the ResourceClaim that was generated for the Pod in the namespace of the Pod.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"requestMappings", "resourceClaimName"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerExtendedResourceRequest"}, + } +} + +func schema_k8sio_api_core_v1_PodIP(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodIP represents a single IP address allocated to the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ip": { + SchemaProps: spec.SchemaProps{ + Description: "IP is the IP address assigned to the pod", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"ip"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodList is a list of Pods.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of pods. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Pod"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Pod", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_PodLogOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodLogOptions is the query options for a Pod's logs REST call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "container": { + SchemaProps: spec.SchemaProps{ + Description: "The container for which to stream logs. Defaults to only container if there is one container in the pod.", + Type: []string{"string"}, + Format: "", + }, + }, + "follow": { + SchemaProps: spec.SchemaProps{ + Description: "Follow the log stream of the pod. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "previous": { + SchemaProps: spec.SchemaProps{ + Description: "Return previous terminated container logs. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "sinceSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "A relative time in seconds before the current time from which to show logs. If this value precedes the time a pod was started, only logs since the pod start will be returned. If this value is in the future, no logs will be returned. Only one of sinceSeconds or sinceTime may be specified.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "sinceTime": { + SchemaProps: spec.SchemaProps{ + Description: "An RFC3339 timestamp from which to show logs. If this value precedes the time a pod was started, only logs since the pod start will be returned. If this value is in the future, no logs will be returned. Only one of sinceSeconds or sinceTime may be specified.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "timestamps": { + SchemaProps: spec.SchemaProps{ + Description: "If true, add an RFC3339 or RFC3339Nano timestamp at the beginning of every line of log output. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "tailLines": { + SchemaProps: spec.SchemaProps{ + Description: "If set, the number of lines from the end of the logs to show. If not specified, logs are shown from the creation of the container or sinceSeconds or sinceTime. Note that when \"TailLines\" is specified, \"Stream\" can only be set to nil or \"All\".", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "limitBytes": { + SchemaProps: spec.SchemaProps{ + Description: "If set, the number of bytes to read from the server before terminating the log output. This may not display a complete final line of logging, and may return slightly more or slightly less than the specified limit.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "insecureSkipTLSVerifyBackend": { + SchemaProps: spec.SchemaProps{ + Description: "insecureSkipTLSVerifyBackend indicates that the apiserver should not confirm the validity of the serving certificate of the backend it is connecting to. This will make the HTTPS connection between the apiserver and the backend insecure. This means the apiserver cannot verify the log data it is receiving came from the real kubelet. If the kubelet is configured to verify the apiserver's TLS credentials, it does not mean the connection to the real kubelet is vulnerable to a man in the middle attack (e.g. an attacker could not intercept the actual log data coming from the real kubelet).", + Type: []string{"boolean"}, + Format: "", + }, + }, + "stream": { + SchemaProps: spec.SchemaProps{ + Description: "Specify which container log stream to return to the client. Acceptable values are \"All\", \"Stdout\" and \"Stderr\". If not specified, \"All\" is used, and both stdout and stderr are returned interleaved. Note that when \"TailLines\" is specified, \"Stream\" can only be set to nil or \"All\".", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PodOS(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodOS defines the OS parameters of a pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is the name of the operating system. The currently supported values are linux and windows. Additional value may be defined in future and can be one of: https://github.com/opencontainers/runtime-spec/blob/master/config.md#platform-specific-configuration Clients should expect to handle additional values and treat unrecognized values in this field as os: null", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodPortForwardOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodPortForwardOptions is the query options to a Pod's port forward call when using WebSockets. The `port` query parameter must specify the port or ports (comma separated) to forward over. Port forwarding over SPDY does not use these options. It requires the port to be passed in the `port` header as part of request.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of ports to forward Required when using WebSockets", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodProxyOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodProxyOptions is the query options to a Pod's proxy call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Path is the URL path to use for the current proxy request to pod.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodReadinessGate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodReadinessGate contains the reference to a pod condition", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "conditionType": { + SchemaProps: spec.SchemaProps{ + Description: "ConditionType refers to a condition in the pod's condition list with matching type.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"conditionType"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodResourceClaim(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodResourceClaim references exactly one ResourceClaim, either directly or by naming a ResourceClaimTemplate which is then turned into a ResourceClaim for the pod.\n\nIt adds a name to it that uniquely identifies the ResourceClaim inside the Pod. Containers that need access to the ResourceClaim reference it with this name.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name uniquely identifies this resource claim inside the pod. This must be a DNS_LABEL.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceClaimName": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaimName is the name of a ResourceClaim object in the same namespace as this pod.\n\nExactly one of ResourceClaimName and ResourceClaimTemplateName must be set.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceClaimTemplateName": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaimTemplateName is the name of a ResourceClaimTemplate object in the same namespace as this pod.\n\nThe template will be used to create a new ResourceClaim, which will be bound to this pod. When this pod is deleted, the ResourceClaim will also be deleted. The pod name and resource name, along with a generated component, will be used to form a unique name for the ResourceClaim, which will be recorded in pod.status.resourceClaimStatuses.\n\nThis field is immutable and no changes will be made to the corresponding ResourceClaim by the control plane after creating the ResourceClaim.\n\nExactly one of ResourceClaimName and ResourceClaimTemplateName must be set.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodResourceClaimStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodResourceClaimStatus is stored in the PodStatus for each PodResourceClaim which references a ResourceClaimTemplate. It stores the generated name for the corresponding ResourceClaim.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name uniquely identifies this resource claim inside the pod. This must match the name of an entry in pod.spec.resourceClaims, which implies that the string must be a DNS_LABEL.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceClaimName": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaimName is the name of the ResourceClaim that was generated for the Pod in the namespace of the Pod. If this is unset, then generating a ResourceClaim was not necessary. The pod.spec.resourceClaims entry can be ignored in this case.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodSchedulingGate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodSchedulingGate is associated to a Pod to guard its scheduling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the scheduling gate. Each scheduling gate must have a unique name field.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PodSecurityContext(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodSecurityContext holds pod-level security attributes and common container settings. Some fields are also present in container.securityContext. Field values of container.securityContext take precedence over field values of PodSecurityContext.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "seLinuxOptions": { + SchemaProps: spec.SchemaProps{ + Description: "The SELinux context to be applied to all containers. If unspecified, the container runtime will allocate a random SELinux context for each container. May also be set in SecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence for that container. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.SELinuxOptions"), + }, + }, + "windowsOptions": { + SchemaProps: spec.SchemaProps{ + Description: "The Windows specific settings applied to all containers. If unspecified, the options within a container's SecurityContext will be used. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence. Note that this field cannot be set when spec.os.name is linux.", + Ref: ref("k8s.io/api/core/v1.WindowsSecurityContextOptions"), + }, + }, + "runAsUser": { + SchemaProps: spec.SchemaProps{ + Description: "The UID to run the entrypoint of the container process. Defaults to user specified in image metadata if unspecified. May also be set in SecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence for that container. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "runAsGroup": { + SchemaProps: spec.SchemaProps{ + Description: "The GID to run the entrypoint of the container process. Uses runtime default if unset. May also be set in SecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence for that container. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "runAsNonRoot": { + SchemaProps: spec.SchemaProps{ + Description: "Indicates that the container must run as a non-root user. If true, the Kubelet will validate the image at runtime to ensure that it does not run as UID 0 (root) and fail to start the container if it does. If unset or false, no such validation will be performed. May also be set in SecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "supplementalGroups": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of groups applied to the first process run in each container, in addition to the container's primary GID and fsGroup (if specified). If the SupplementalGroupsPolicy feature is enabled, the supplementalGroupsPolicy field determines whether these are in addition to or instead of any group memberships defined in the container image. If unspecified, no additional groups are added, though group memberships defined in the container image may still be used, depending on the supplementalGroupsPolicy field. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + "supplementalGroupsPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Defines how supplemental groups of the first container processes are calculated. Valid values are \"Merge\" and \"Strict\". If not specified, \"Merge\" is used. (Alpha) Using the field requires the SupplementalGroupsPolicy feature gate to be enabled and the container runtime must implement support for this feature. Note that this field cannot be set when spec.os.name is windows.\n\nPossible enum values:\n - `\"Merge\"` means that the container's provided SupplementalGroups and FsGroup (specified in SecurityContext) will be merged with the primary user's groups as defined in the container image (in /etc/group).\n - `\"Strict\"` means that the container's provided SupplementalGroups and FsGroup (specified in SecurityContext) will be used instead of any groups defined in the container image.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Merge", "Strict"}, + }, + }, + "fsGroup": { + SchemaProps: spec.SchemaProps{ + Description: "A special supplemental group that applies to all containers in a pod. Some volume types allow the Kubelet to change the ownership of that volume to be owned by the pod:\n\n1. The owning GID will be the FSGroup 2. The setgid bit is set (new files created in the volume will be owned by FSGroup) 3. The permission bits are OR'd with rw-rw----\n\nIf unset, the Kubelet will not modify the ownership and permissions of any volume. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "sysctls": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Sysctls hold a list of namespaced sysctls used for the pod. Pods with unsupported sysctls (by the container runtime) might fail to launch. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Sysctl"), + }, + }, + }, + }, + }, + "fsGroupChangePolicy": { + SchemaProps: spec.SchemaProps{ + Description: "fsGroupChangePolicy defines behavior of changing ownership and permission of the volume before being exposed inside Pod. This field will only apply to volume types which support fsGroup based ownership(and permissions). It will have no effect on ephemeral volume types such as: secret, configmaps and emptydir. Valid values are \"OnRootMismatch\" and \"Always\". If not specified, \"Always\" is used. Note that this field cannot be set when spec.os.name is windows.\n\nPossible enum values:\n - `\"Always\"` indicates that volume's ownership and permissions should always be changed whenever volume is mounted inside a Pod. This the default behavior.\n - `\"OnRootMismatch\"` indicates that volume's ownership and permissions will be changed only when permission and ownership of root directory does not match with expected permissions on the volume. This can help shorten the time it takes to change ownership and permissions of a volume.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "OnRootMismatch"}, + }, + }, + "seccompProfile": { + SchemaProps: spec.SchemaProps{ + Description: "The seccomp options to use by the containers in this pod. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.SeccompProfile"), + }, + }, + "appArmorProfile": { + SchemaProps: spec.SchemaProps{ + Description: "appArmorProfile is the AppArmor options to use by the containers in this pod. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.AppArmorProfile"), + }, + }, + "seLinuxChangePolicy": { + SchemaProps: spec.SchemaProps{ + Description: "seLinuxChangePolicy defines how the container's SELinux label is applied to all volumes used by the Pod. It has no effect on nodes that do not support SELinux or to volumes does not support SELinux. Valid values are \"MountOption\" and \"Recursive\".\n\n\"Recursive\" means relabeling of all files on all Pod volumes by the container runtime. This may be slow for large volumes, but allows mixing privileged and unprivileged Pods sharing the same volume on the same node.\n\n\"MountOption\" mounts all eligible Pod volumes with `-o context` mount option. This requires all Pods that share the same volume to use the same SELinux label. It is not possible to share the same volume among privileged and unprivileged Pods. Eligible volumes are in-tree FibreChannel and iSCSI volumes, and all CSI volumes whose CSI driver announces SELinux support by setting spec.seLinuxMount: true in their CSIDriver instance. Other volumes are always re-labelled recursively. \"MountOption\" value is allowed only when SELinuxMount feature gate is enabled.\n\nIf not specified and SELinuxMount feature gate is enabled, \"MountOption\" is used. If not specified and SELinuxMount feature gate is disabled, \"MountOption\" is used for ReadWriteOncePod volumes and \"Recursive\" for all other volumes.\n\nThis field affects only Pods that have SELinux label set, either in PodSecurityContext or in SecurityContext of all containers.\n\nAll Pods that use the same volume should use the same seLinuxChangePolicy, otherwise some pods can get stuck in ContainerCreating state. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AppArmorProfile", "k8s.io/api/core/v1.SELinuxOptions", "k8s.io/api/core/v1.SeccompProfile", "k8s.io/api/core/v1.Sysctl", "k8s.io/api/core/v1.WindowsSecurityContextOptions"}, + } +} + +func schema_k8sio_api_core_v1_PodSignature(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Describes the class of pods that should avoid this node. Exactly one field should be set.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "podController": { + SchemaProps: spec.SchemaProps{ + Description: "Reference to controller whose pods should avoid this node.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference"}, + } +} + +func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodSpec is a description of a pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge,retainKeys", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of volumes that can be mounted by containers belonging to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Volume"), + }, + }, + }, + }, + }, + "initContainers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of initialization containers belonging to the pod. Init containers are executed in order prior to containers being started. If any init container fails, the pod is considered to have failed and is handled according to its restartPolicy. The name for an init container or normal container must be unique among all containers. Init containers may not have Lifecycle actions, Readiness probes, Liveness probes, or Startup probes. The resourceRequirements of an init container are taken into account during scheduling by finding the highest request/limit for each resource type, and then using the max of that value or the sum of the normal containers. Limits are applied to init containers in a similar fashion. Init containers cannot currently be added or removed. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/init-containers/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Container"), + }, + }, + }, + }, + }, + "containers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of containers belonging to the pod. Containers cannot currently be added or removed. There must be at least one container in a Pod. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Container"), + }, + }, + }, + }, + }, + "ephemeralContainers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of ephemeral containers run in this pod. Ephemeral containers may be run in an existing pod to perform user-initiated actions such as debugging. This list cannot be specified when creating a pod, and it cannot be modified by updating the pod spec. In order to add an ephemeral container to an existing pod, use the pod's ephemeralcontainers subresource.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EphemeralContainer"), + }, + }, + }, + }, + }, + "restartPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Restart policy for all containers within the pod. One of Always, OnFailure, Never. In some contexts, only a subset of those values may be permitted. Default to Always. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle/#restart-policy\n\nPossible enum values:\n - `\"Always\"`\n - `\"Never\"`\n - `\"OnFailure\"`", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Always", "Never", "OnFailure"}, + }, + }, + "terminationGracePeriodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Optional duration in seconds the pod needs to terminate gracefully. May be decreased in delete request. Value must be non-negative integer. The value zero indicates stop immediately via the kill signal (no opportunity to shut down). If this value is nil, the default grace period will be used instead. The grace period is the duration in seconds after the processes running in the pod are sent a termination signal and the time when the processes are forcibly halted with a kill signal. Set this value longer than the expected cleanup time for your process. Defaults to 30 seconds.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "activeDeadlineSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Optional duration in seconds the pod may be active on the node relative to StartTime before the system will actively try to mark it failed and kill associated containers. Value must be a positive integer.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "dnsPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Set DNS policy for the pod. Defaults to \"ClusterFirst\". Valid values are 'ClusterFirstWithHostNet', 'ClusterFirst', 'Default' or 'None'. DNS parameters given in DNSConfig will be merged with the policy selected with DNSPolicy. To have DNS options set along with hostNetwork, you have to specify DNS policy explicitly to 'ClusterFirstWithHostNet'.\n\nPossible enum values:\n - `\"ClusterFirst\"` indicates that the pod should use cluster DNS first unless hostNetwork is true, if it is available, then fall back on the default (as determined by kubelet) DNS settings.\n - `\"ClusterFirstWithHostNet\"` indicates that the pod should use cluster DNS first, if it is available, then fall back on the default (as determined by kubelet) DNS settings.\n - `\"Default\"` indicates that the pod should use the default (as determined by kubelet) DNS settings.\n - `\"None\"` indicates that the pod should use empty DNS settings. DNS parameters such as nameservers and search paths should be defined via DNSConfig.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ClusterFirst", "ClusterFirstWithHostNet", "Default", "None"}, + }, + }, + "nodeSelector": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "NodeSelector is a selector which must be true for the pod to fit on a node. Selector which must match a node's labels for the pod to be scheduled on that node. More info: https://kubernetes.io/docs/concepts/configuration/assign-pod-node/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "serviceAccountName": { + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountName is the name of the ServiceAccount to use to run this pod. More info: https://kubernetes.io/docs/tasks/configure-pod-container/configure-service-account/", + Type: []string{"string"}, + Format: "", + }, + }, + "serviceAccount": { + SchemaProps: spec.SchemaProps{ + Description: "DeprecatedServiceAccount is a deprecated alias for ServiceAccountName. Deprecated: Use serviceAccountName instead.", + Type: []string{"string"}, + Format: "", + }, + }, + "automountServiceAccountToken": { + SchemaProps: spec.SchemaProps{ + Description: "AutomountServiceAccountToken indicates whether a service account token should be automatically mounted.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "nodeName": { + SchemaProps: spec.SchemaProps{ + Description: "NodeName indicates in which node this pod is scheduled. If empty, this pod is a candidate for scheduling by the scheduler defined in schedulerName. Once this field is set, the kubelet for this node becomes responsible for the lifecycle of this pod. This field should not be used to express a desire for the pod to be scheduled on a specific node. https://kubernetes.io/docs/concepts/scheduling-eviction/assign-pod-node/#nodename", + Type: []string{"string"}, + Format: "", + }, + }, + "hostNetwork": { + SchemaProps: spec.SchemaProps{ + Description: "Host networking requested for this pod. Use the host's network namespace. When using HostNetwork you should specify ports so the scheduler is aware. When `hostNetwork` is true, specified `hostPort` fields in port definitions must match `containerPort`, and unspecified `hostPort` fields in port definitions are defaulted to match `containerPort`. Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "hostPID": { + SchemaProps: spec.SchemaProps{ + Description: "Use the host's pid namespace. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "hostIPC": { + SchemaProps: spec.SchemaProps{ + Description: "Use the host's ipc namespace. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "shareProcessNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "Share a single process namespace between all of the containers in a pod. When this is set containers will be able to view and signal processes from other containers in the same pod, and the first process in each container will not be assigned PID 1. HostPID and ShareProcessNamespace cannot both be set. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "SecurityContext holds pod-level security attributes and common container settings. Optional: Defaults to empty. See type description for default values of each field.", + Ref: ref("k8s.io/api/core/v1.PodSecurityContext"), + }, + }, + "imagePullSecrets": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ImagePullSecrets is an optional list of references to secrets in the same namespace to use for pulling any of the images used by this PodSpec. If specified, these secrets will be passed to individual puller implementations for them to use. More info: https://kubernetes.io/docs/concepts/containers/images#specifying-imagepullsecrets-on-a-pod", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + "hostname": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the hostname of the Pod If not specified, the pod's hostname will be set to a system-defined value.", + Type: []string{"string"}, + Format: "", + }, + }, + "subdomain": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the fully qualified Pod hostname will be \"...svc.\". If not specified, the pod will not have a domainname at all.", + Type: []string{"string"}, + Format: "", + }, + }, + "affinity": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's scheduling constraints", + Ref: ref("k8s.io/api/core/v1.Affinity"), + }, + }, + "schedulerName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod will be dispatched by specified scheduler. If not specified, the pod will be dispatched by default scheduler.", + Type: []string{"string"}, + Format: "", + }, + }, + "tolerations": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's tolerations.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Toleration"), + }, + }, + }, + }, + }, + "hostAliases": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "ip", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "ip", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "HostAliases is an optional list of hosts and IPs that will be injected into the pod's hosts file if specified.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.HostAlias"), + }, + }, + }, + }, + }, + "priorityClassName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, indicates the pod's priority. \"system-node-critical\" and \"system-cluster-critical\" are two special keywords which indicate the highest priorities with the former being the highest priority. Any other name must be defined by creating a PriorityClass object with that name. If not specified, the pod priority will be default or zero if there is no default.", + Type: []string{"string"}, + Format: "", + }, + }, + "priority": { + SchemaProps: spec.SchemaProps{ + Description: "The priority value. Various system components use this field to find the priority of the pod. When Priority Admission Controller is enabled, it prevents users from setting this field. The admission controller populates this field from PriorityClassName. The higher the value, the higher the priority.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "dnsConfig": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the DNS parameters of a pod. Parameters specified here will be merged to the generated DNS configuration based on DNSPolicy.", + Ref: ref("k8s.io/api/core/v1.PodDNSConfig"), + }, + }, + "readinessGates": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If specified, all readiness gates will be evaluated for pod readiness. A pod is ready when all its containers are ready AND all conditions specified in the readiness gates have status equal to \"True\" More info: https://git.k8s.io/enhancements/keps/sig-network/580-pod-readiness-gates", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodReadinessGate"), + }, + }, + }, + }, + }, + "runtimeClassName": { + SchemaProps: spec.SchemaProps{ + Description: "RuntimeClassName refers to a RuntimeClass object in the node.k8s.io group, which should be used to run this pod. If no RuntimeClass resource matches the named class, the pod will not be run. If unset or empty, the \"legacy\" RuntimeClass will be used, which is an implicit class with an empty definition that uses the default runtime handler. More info: https://git.k8s.io/enhancements/keps/sig-node/585-runtime-class", + Type: []string{"string"}, + Format: "", + }, + }, + "enableServiceLinks": { + SchemaProps: spec.SchemaProps{ + Description: "EnableServiceLinks indicates whether information about services should be injected into pod's environment variables, matching the syntax of Docker links. Optional: Defaults to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "preemptionPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "PreemptionPolicy is the Policy for preempting pods with lower priority. One of Never, PreemptLowerPriority. Defaults to PreemptLowerPriority if unset.\n\nPossible enum values:\n - `\"Never\"` means that pod never preempts other pods with lower priority.\n - `\"PreemptLowerPriority\"` means that pod can preempt other pods with lower priority.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Never", "PreemptLowerPriority"}, + }, + }, + "overhead": { + SchemaProps: spec.SchemaProps{ + Description: "Overhead represents the resource overhead associated with running a pod for a given RuntimeClass. This field will be autopopulated at admission time by the RuntimeClass admission controller. If the RuntimeClass admission controller is enabled, overhead must not be set in Pod create requests. The RuntimeClass admission controller will reject Pod create requests which have the overhead already set. If RuntimeClass is configured and selected in the PodSpec, Overhead will be set to the value defined in the corresponding RuntimeClass, otherwise it will remain unset and treated as zero. More info: https://git.k8s.io/enhancements/keps/sig-node/688-pod-overhead/README.md", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "topologySpreadConstraints": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "topologyKey", + "whenUnsatisfiable", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "topologyKey", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "TopologySpreadConstraints describes how a group of pods ought to spread across topology domains. Scheduler will schedule pods in a way which abides by the constraints. All topologySpreadConstraints are ANDed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.TopologySpreadConstraint"), + }, + }, + }, + }, + }, + "setHostnameAsFQDN": { + SchemaProps: spec.SchemaProps{ + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "os": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the OS of the containers in the pod. Some pod and container fields are restricted if this is set.\n\nIf the OS field is set to linux, the following fields must be unset: -securityContext.windowsOptions\n\nIf the OS field is set to windows, following fields must be unset: - spec.hostPID - spec.hostIPC - spec.hostUsers - spec.resources - spec.securityContext.appArmorProfile - spec.securityContext.seLinuxOptions - spec.securityContext.seccompProfile - spec.securityContext.fsGroup - spec.securityContext.fsGroupChangePolicy - spec.securityContext.sysctls - spec.shareProcessNamespace - spec.securityContext.runAsUser - spec.securityContext.runAsGroup - spec.securityContext.supplementalGroups - spec.securityContext.supplementalGroupsPolicy - spec.containers[*].securityContext.appArmorProfile - spec.containers[*].securityContext.seLinuxOptions - spec.containers[*].securityContext.seccompProfile - spec.containers[*].securityContext.capabilities - spec.containers[*].securityContext.readOnlyRootFilesystem - spec.containers[*].securityContext.privileged - spec.containers[*].securityContext.allowPrivilegeEscalation - spec.containers[*].securityContext.procMount - spec.containers[*].securityContext.runAsUser - spec.containers[*].securityContext.runAsGroup", + Ref: ref("k8s.io/api/core/v1.PodOS"), + }, + }, + "hostUsers": { + SchemaProps: spec.SchemaProps{ + Description: "Use the host's user namespace. Optional: Default to true. If set to true or not present, the pod will be run in the host user namespace, useful for when the pod needs a feature only available to the host user namespace, such as loading a kernel module with CAP_SYS_MODULE. When set to false, a new userns is created for the pod. Setting false is useful for mitigating container breakout vulnerabilities even allowing users to run their containers as root without actually having root privileges on the host. This field is alpha-level and is only honored by servers that enable the UserNamespacesSupport feature.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "schedulingGates": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "SchedulingGates is an opaque list of values that if specified will block scheduling the pod. If schedulingGates is not empty, the pod will stay in the SchedulingGated state and the scheduler will not attempt to schedule the pod.\n\nSchedulingGates can only be set at pod creation time, and be removed only afterwards.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodSchedulingGate"), + }, + }, + }, + }, + }, + "resourceClaims": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge,retainKeys", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaims defines which ResourceClaims must be allocated and reserved before the Pod is allowed to start. The resources will be made available to those containers which consume them by name.\n\nThis is an alpha field and requires enabling the DynamicResourceAllocation feature gate.\n\nThis field is immutable.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodResourceClaim"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Resources is the total amount of CPU and Memory resources required by all containers in the pod. It supports specifying Requests and Limits for \"cpu\", \"memory\" and \"hugepages-\" resource names only. ResourceClaims are not supported.\n\nThis field enables fine-grained control over resource allocation for the entire pod, allowing resource sharing among containers in a pod.\n\nThis is an alpha field and requires enabling the PodLevelResources feature gate.", + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "hostnameOverride": { + SchemaProps: spec.SchemaProps{ + Description: "HostnameOverride specifies an explicit override for the pod's hostname as perceived by the pod. This field only specifies the pod's hostname and does not affect its DNS records. When this field is set to a non-empty string: - It takes precedence over the values set in `hostname` and `subdomain`. - The Pod's hostname will be set to this value. - `setHostnameAsFQDN` must be nil or set to false. - `hostNetwork` must be set to false.\n\nThis field must be a valid DNS subdomain as defined in RFC 1123 and contain at most 64 characters. Requires the HostnameOverride feature gate to be enabled.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"containers"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Affinity", "k8s.io/api/core/v1.Container", "k8s.io/api/core/v1.EphemeralContainer", "k8s.io/api/core/v1.HostAlias", "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/api/core/v1.PodDNSConfig", "k8s.io/api/core/v1.PodOS", "k8s.io/api/core/v1.PodReadinessGate", "k8s.io/api/core/v1.PodResourceClaim", "k8s.io/api/core/v1.PodSchedulingGate", "k8s.io/api/core/v1.PodSecurityContext", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.Toleration", "k8s.io/api/core/v1.TopologySpreadConstraint", "k8s.io/api/core/v1.Volume", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_PodStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodStatus represents information about the status of a pod. Status may trail the actual state of a system, especially if the node that hosts the pod cannot contact the control plane.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "observedGeneration": { + SchemaProps: spec.SchemaProps{ + Description: "If set, this represents the .metadata.generation that the pod status was set based upon. This is an alpha field. Enable PodObservedGenerationTracking to be able to use this field.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "phase": { + SchemaProps: spec.SchemaProps{ + Description: "The phase of a Pod is a simple, high-level summary of where the Pod is in its lifecycle. The conditions array, the reason and message fields, and the individual container status arrays contain more detail about the pod's status. There are five possible phase values:\n\nPending: The pod has been accepted by the Kubernetes system, but one or more of the container images has not been created. This includes time before being scheduled as well as time spent downloading images over the network, which could take a while. Running: The pod has been bound to a node, and all of the containers have been created. At least one container is still running, or is in the process of starting or restarting. Succeeded: All containers in the pod have terminated in success, and will not be restarted. Failed: All containers in the pod have terminated, and at least one container has terminated in failure. The container either exited with non-zero status or was terminated by the system. Unknown: For some reason the state of the pod could not be obtained, typically due to an error in communicating with the host of the pod.\n\nMore info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-phase\n\nPossible enum values:\n - `\"Failed\"` means that all containers in the pod have terminated, and at least one container has terminated in a failure (exited with a non-zero exit code or was stopped by the system).\n - `\"Pending\"` means the pod has been accepted by the system, but one or more of the containers has not been started. This includes time before being bound to a node, as well as time spent pulling images onto the host.\n - `\"Running\"` means the pod has been bound to a node and all of the containers have been started. At least one container is still running or is in the process of being restarted.\n - `\"Succeeded\"` means that all containers in the pod have voluntarily terminated with a container exit code of 0, and the system is not going to restart any of these containers.\n - `\"Unknown\"` means that for some reason the state of the pod could not be obtained, typically due to an error in communicating with the host of the pod. Deprecated: It isn't being set since 2015 (74da3b14b0c0f658b3bb8d2def5094686d0e9095)", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Failed", "Pending", "Running", "Succeeded", "Unknown"}, + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Current service state of pod. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-conditions", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodCondition"), + }, + }, + }, + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human readable message indicating details about why the pod is in this condition.", + Type: []string{"string"}, + Format: "", + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "A brief CamelCase message indicating details about why the pod is in this state. e.g. 'Evicted'", + Type: []string{"string"}, + Format: "", + }, + }, + "nominatedNodeName": { + SchemaProps: spec.SchemaProps{ + Description: "nominatedNodeName is set only when this pod preempts other pods on the node, but it cannot be scheduled right away as preemption victims receive their graceful termination periods. This field does not guarantee that the pod will be scheduled on this node. Scheduler may decide to place the pod elsewhere if other nodes become available sooner. Scheduler may also decide to give the resources on this node to a higher priority pod that is created after preemption. As a result, this field may be different than PodSpec.nodeName when the pod is scheduled.", + Type: []string{"string"}, + Format: "", + }, + }, + "hostIP": { + SchemaProps: spec.SchemaProps{ + Description: "hostIP holds the IP address of the host to which the pod is assigned. Empty if the pod has not started yet. A pod can be assigned to a node that has a problem in kubelet which in turns mean that HostIP will not be updated even if there is a node is assigned to pod", + Type: []string{"string"}, + Format: "", + }, + }, + "hostIPs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + "x-kubernetes-patch-merge-key": "ip", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "hostIPs holds the IP addresses allocated to the host. If this field is specified, the first entry must match the hostIP field. This list is empty if the pod has not started yet. A pod can be assigned to a node that has a problem in kubelet which in turns means that HostIPs will not be updated even if there is a node is assigned to this pod.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.HostIP"), + }, + }, + }, + }, + }, + "podIP": { + SchemaProps: spec.SchemaProps{ + Description: "podIP address allocated to the pod. Routable at least within the cluster. Empty if not yet allocated.", + Type: []string{"string"}, + Format: "", + }, + }, + "podIPs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "ip", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "ip", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "podIPs holds the IP addresses allocated to the pod. If this field is specified, the 0th entry must match the podIP field. Pods may be allocated at most 1 value for each of IPv4 and IPv6. This list is empty if no IPs have been allocated yet.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodIP"), + }, + }, + }, + }, + }, + "startTime": { + SchemaProps: spec.SchemaProps{ + Description: "RFC 3339 date and time at which the object was acknowledged by the Kubelet. This is before the Kubelet pulled the container image(s) for the pod.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "initContainerStatuses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Statuses of init containers in this pod. The most recent successful non-restartable init container will have ready = true, the most recently started container will have startTime set. Each init container in the pod should have at most one status in this list, and all statuses should be for containers in the pod. However this is not enforced. If a status for a non-existent container is present in the list, or the list has duplicate names, the behavior of various Kubernetes components is not defined and those statuses might be ignored. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle/#pod-and-container-status", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerStatus"), + }, + }, + }, + }, + }, + "containerStatuses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Statuses of containers in this pod. Each container in the pod should have at most one status in this list, and all statuses should be for containers in the pod. However this is not enforced. If a status for a non-existent container is present in the list, or the list has duplicate names, the behavior of various Kubernetes components is not defined and those statuses might be ignored. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-and-container-status", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerStatus"), + }, + }, + }, + }, + }, + "qosClass": { + SchemaProps: spec.SchemaProps{ + Description: "The Quality of Service (QOS) classification assigned to the pod based on resource requirements See PodQOSClass type for available QOS classes More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-qos/#quality-of-service-classes\n\nPossible enum values:\n - `\"BestEffort\"` is the BestEffort qos class.\n - `\"Burstable\"` is the Burstable qos class.\n - `\"Guaranteed\"` is the Guaranteed qos class.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"BestEffort", "Burstable", "Guaranteed"}, + }, + }, + "ephemeralContainerStatuses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Statuses for any ephemeral containers that have run in this pod. Each ephemeral container in the pod should have at most one status in this list, and all statuses should be for containers in the pod. However this is not enforced. If a status for a non-existent container is present in the list, or the list has duplicate names, the behavior of various Kubernetes components is not defined and those statuses might be ignored. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#pod-and-container-status", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ContainerStatus"), + }, + }, + }, + }, + }, + "resize": { + SchemaProps: spec.SchemaProps{ + Description: "Status of resources resize desired for pod's containers. It is empty if no resources resize is pending. Any changes to container resources will automatically set this to \"Proposed\" Deprecated: Resize status is moved to two pod conditions PodResizePending and PodResizeInProgress. PodResizePending will track states where the spec has been resized, but the Kubelet has not yet allocated the resources. PodResizeInProgress will track in-progress resizes, and should be present whenever allocated resources != acknowledged resources.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceClaimStatuses": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge,retainKeys", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Status of resource claims.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodResourceClaimStatus"), + }, + }, + }, + }, + }, + "extendedResourceClaimStatus": { + SchemaProps: spec.SchemaProps{ + Description: "Status of extended resource claim backed by DRA.", + Ref: ref("k8s.io/api/core/v1.PodExtendedResourceClaimStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ContainerStatus", "k8s.io/api/core/v1.HostIP", "k8s.io/api/core/v1.PodCondition", "k8s.io/api/core/v1.PodExtendedResourceClaimStatus", "k8s.io/api/core/v1.PodIP", "k8s.io/api/core/v1.PodResourceClaimStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PodStatusResult(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodStatusResult is a wrapper for PodStatus returned by kubelet that can be encode/decoded", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Most recently observed status of the pod. This data may not be up to date. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PodTemplate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodTemplate describes a template for creating copies of a predefined pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "template": { + SchemaProps: spec.SchemaProps{ + Description: "Template defines the pods that will be created from this pod template. https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodTemplateSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodTemplateSpec", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PodTemplateList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodTemplateList is a list of PodTemplates.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of pod templates", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodTemplate"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodTemplate", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_PodTemplateSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodTemplateSpec describes the data a pod should have when created from a template", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Specification of the desired behavior of the pod. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodSpec", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_PortStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PortStatus represents the error condition of a service port", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "port": { + SchemaProps: spec.SchemaProps{ + Description: "Port is the port number of the service port of which status is recorded here", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "protocol": { + SchemaProps: spec.SchemaProps{ + Description: "Protocol is the protocol of the service port of which status is recorded here The supported values are: \"TCP\", \"UDP\", \"SCTP\"\n\nPossible enum values:\n - `\"SCTP\"` is the SCTP protocol.\n - `\"TCP\"` is the TCP protocol.\n - `\"UDP\"` is the UDP protocol.", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SCTP", "TCP", "UDP"}, + }, + }, + "error": { + SchemaProps: spec.SchemaProps{ + Description: "Error is to record the problem with the service port The format of the error shall comply with the following rules: - built-in error values shall be specified in this file and those shall use\n CamelCase names\n- cloud provider specific error values must have names that comply with the\n format foo.example.com/CamelCase.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"port", "protocol"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PortworxVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PortworxVolumeSource represents a Portworx volume resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeID": { + SchemaProps: spec.SchemaProps{ + Description: "volumeID uniquely identifies a Portworx volume", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fSType represents the filesystem type to mount Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"volumeID"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_PreferAvoidPodsEntry(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Describes a class of pods that should avoid this node.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "podSignature": { + SchemaProps: spec.SchemaProps{ + Description: "The class of pods.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodSignature"), + }, + }, + "evictionTime": { + SchemaProps: spec.SchemaProps{ + Description: "Time at which this entry was added to the list.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "(brief) reason why this entry was added to the list.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Human readable message indicating why this entry was added to the list.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"podSignature"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodSignature", "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_PreferredSchedulingTerm(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "An empty preferred scheduling term matches all objects with implicit weight 0 (i.e. it's a no-op). A null preferred scheduling term matches no objects (i.e. is also a no-op).", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "weight": { + SchemaProps: spec.SchemaProps{ + Description: "Weight associated with matching the corresponding nodeSelectorTerm, in the range 1-100.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "preference": { + SchemaProps: spec.SchemaProps{ + Description: "A node selector term, associated with the corresponding weight.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.NodeSelectorTerm"), + }, + }, + }, + Required: []string{"weight", "preference"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSelectorTerm"}, + } +} + +func schema_k8sio_api_core_v1_Probe(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Probe describes a health check to be performed against a container to determine whether it is alive or ready to receive traffic.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "exec": { + SchemaProps: spec.SchemaProps{ + Description: "Exec specifies a command to execute in the container.", + Ref: ref("k8s.io/api/core/v1.ExecAction"), + }, + }, + "httpGet": { + SchemaProps: spec.SchemaProps{ + Description: "HTTPGet specifies an HTTP GET request to perform.", + Ref: ref("k8s.io/api/core/v1.HTTPGetAction"), + }, + }, + "tcpSocket": { + SchemaProps: spec.SchemaProps{ + Description: "TCPSocket specifies a connection to a TCP port.", + Ref: ref("k8s.io/api/core/v1.TCPSocketAction"), + }, + }, + "grpc": { + SchemaProps: spec.SchemaProps{ + Description: "GRPC specifies a GRPC HealthCheckRequest.", + Ref: ref("k8s.io/api/core/v1.GRPCAction"), + }, + }, + "initialDelaySeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Number of seconds after the container has started before liveness probes are initiated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "timeoutSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Number of seconds after which the probe times out. Defaults to 1 second. Minimum value is 1. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "periodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "How often (in seconds) to perform the probe. Default to 10 seconds. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "successThreshold": { + SchemaProps: spec.SchemaProps{ + Description: "Minimum consecutive successes for the probe to be considered successful after having failed. Defaults to 1. Must be 1 for liveness and startup. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "failureThreshold": { + SchemaProps: spec.SchemaProps{ + Description: "Minimum consecutive failures for the probe to be considered failed after having succeeded. Defaults to 3. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "terminationGracePeriodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Optional duration in seconds the pod needs to terminate gracefully upon probe failure. The grace period is the duration in seconds after the processes running in the pod are sent a termination signal and the time when the processes are forcibly halted with a kill signal. Set this value longer than the expected cleanup time for your process. If this value is nil, the pod's terminationGracePeriodSeconds will be used. Otherwise, this value overrides the value provided by the pod spec. Value must be non-negative integer. The value zero indicates stop immediately via the kill signal (no opportunity to shut down). This is a beta field and requires enabling ProbeTerminationGracePeriod feature gate. Minimum value is 1. spec.terminationGracePeriodSeconds is used if unset.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ExecAction", "k8s.io/api/core/v1.GRPCAction", "k8s.io/api/core/v1.HTTPGetAction", "k8s.io/api/core/v1.TCPSocketAction"}, + } +} + +func schema_k8sio_api_core_v1_ProbeHandler(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ProbeHandler defines a specific action that should be taken in a probe. One and only one of the fields must be specified.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "exec": { + SchemaProps: spec.SchemaProps{ + Description: "Exec specifies a command to execute in the container.", + Ref: ref("k8s.io/api/core/v1.ExecAction"), + }, + }, + "httpGet": { + SchemaProps: spec.SchemaProps{ + Description: "HTTPGet specifies an HTTP GET request to perform.", + Ref: ref("k8s.io/api/core/v1.HTTPGetAction"), + }, + }, + "tcpSocket": { + SchemaProps: spec.SchemaProps{ + Description: "TCPSocket specifies a connection to a TCP port.", + Ref: ref("k8s.io/api/core/v1.TCPSocketAction"), + }, + }, + "grpc": { + SchemaProps: spec.SchemaProps{ + Description: "GRPC specifies a GRPC HealthCheckRequest.", + Ref: ref("k8s.io/api/core/v1.GRPCAction"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ExecAction", "k8s.io/api/core/v1.GRPCAction", "k8s.io/api/core/v1.HTTPGetAction", "k8s.io/api/core/v1.TCPSocketAction"}, + } +} + +func schema_k8sio_api_core_v1_ProjectedVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a projected volume source", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "sources": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "sources is the list of volume projections. Each entry in this list handles one source.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeProjection"), + }, + }, + }, + }, + }, + "defaultMode": { + SchemaProps: spec.SchemaProps{ + Description: "defaultMode are the mode bits used to set permissions on created files by default. Must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. Directories within the path are not affected by this setting. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.VolumeProjection"}, + } +} + +func schema_k8sio_api_core_v1_QuobyteVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Quobyte mount that lasts the lifetime of a pod. Quobyte volumes do not support ownership management or SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "registry": { + SchemaProps: spec.SchemaProps{ + Description: "registry represents a single or multiple Quobyte Registry services specified as a string as host:port pair (multiple entries are separated with commas) which acts as the central registry for volumes", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "volume": { + SchemaProps: spec.SchemaProps{ + Description: "volume is a string that references an already created Quobyte volume by name.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the Quobyte volume to be mounted with read-only permissions. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "user to map volume access to Defaults to serivceaccount user", + Type: []string{"string"}, + Format: "", + }, + }, + "group": { + SchemaProps: spec.SchemaProps{ + Description: "group to map volume access to Default is no group", + Type: []string{"string"}, + Format: "", + }, + }, + "tenant": { + SchemaProps: spec.SchemaProps{ + Description: "tenant owning the given Quobyte volume in the Backend Used with dynamically provisioned Quobyte volumes, value is set by the plugin", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"registry", "volume"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_RBDPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Rados Block Device mount that lasts the lifetime of a pod. RBD volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "monitors": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "monitors is a collection of Ceph monitors. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "image is the rados image name. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#rbd", + Type: []string{"string"}, + Format: "", + }, + }, + "pool": { + SchemaProps: spec.SchemaProps{ + Description: "pool is the rados pool name. Default is rbd. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "rbd", + Type: []string{"string"}, + Format: "", + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "user is the rados user name. Default is admin. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "admin", + Type: []string{"string"}, + Format: "", + }, + }, + "keyring": { + SchemaProps: spec.SchemaProps{ + Description: "keyring is the path to key ring for RBDUser. Default is /etc/ceph/keyring. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "/etc/ceph/keyring", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is name of the authentication secret for RBDUser. If provided overrides keyring. Default is nil. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the ReadOnly setting in VolumeMounts. Defaults to false. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"monitors", "image"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_RBDVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a Rados Block Device mount that lasts the lifetime of a pod. RBD volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "monitors": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "monitors is a collection of Ceph monitors. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "image is the rados image name. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type of the volume that you want to mount. Tip: Ensure that the filesystem type is supported by the host operating system. Examples: \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified. More info: https://kubernetes.io/docs/concepts/storage/volumes#rbd", + Type: []string{"string"}, + Format: "", + }, + }, + "pool": { + SchemaProps: spec.SchemaProps{ + Description: "pool is the rados pool name. Default is rbd. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "rbd", + Type: []string{"string"}, + Format: "", + }, + }, + "user": { + SchemaProps: spec.SchemaProps{ + Description: "user is the rados user name. Default is admin. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "admin", + Type: []string{"string"}, + Format: "", + }, + }, + "keyring": { + SchemaProps: spec.SchemaProps{ + Description: "keyring is the path to key ring for RBDUser. Default is /etc/ceph/keyring. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Default: "/etc/ceph/keyring", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef is name of the authentication secret for RBDUser. If provided overrides keyring. Default is nil. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly here will force the ReadOnly setting in VolumeMounts. Defaults to false. More info: https://examples.k8s.io/volumes/rbd/README.md#how-to-use-it", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"monitors", "image"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_RangeAllocation(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "RangeAllocation is not a public type.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "range": { + SchemaProps: spec.SchemaProps{ + Description: "Range is string that identifies the range represented by 'data'.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "data": { + SchemaProps: spec.SchemaProps{ + Description: "Data is a bit array containing all allocated addresses in the previous segment.", + Type: []string{"string"}, + Format: "byte", + }, + }, + }, + Required: []string{"range", "data"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ReplicationController(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReplicationController represents the configuration of a replication controller.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "If the Labels of a ReplicationController are empty, they are defaulted to be the same as the Pod(s) that the replication controller manages. Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the specification of the desired behavior of the replication controller. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ReplicationControllerSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status is the most recently observed status of the replication controller. This data may be out of date by some window of time. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ReplicationControllerStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ReplicationControllerSpec", "k8s.io/api/core/v1.ReplicationControllerStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ReplicationControllerCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReplicationControllerCondition describes the state of a replication controller at a certain point.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of replication controller condition.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "The last time the condition transitioned from one status to another.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "The reason for the condition's last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human readable message indicating details about the transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_ReplicationControllerList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReplicationControllerList is a collection of replication controllers.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of replication controllers. More info: https://kubernetes.io/docs/concepts/workloads/controllers/replicationcontroller", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ReplicationController"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ReplicationController", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ReplicationControllerSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReplicationControllerSpec is the specification of a replication controller.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "replicas": { + SchemaProps: spec.SchemaProps{ + Description: "Replicas is the number of desired replicas. This is a pointer to distinguish between explicit zero and unspecified. Defaults to 1. More info: https://kubernetes.io/docs/concepts/workloads/controllers/replicationcontroller#what-is-a-replicationcontroller", + Default: 1, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "minReadySeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Minimum number of seconds for which a newly created pod should be ready without any of its container crashing, for it to be considered available. Defaults to 0 (pod will be considered available as soon as it is ready)", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "selector": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Selector is a label query over pods that should match the Replicas count. If Selector is empty, it is defaulted to the labels present on the Pod template. Label keys and values that must match in order to be controlled by this replication controller, if empty defaulted to labels on Pod template. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/labels/#label-selectors", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "template": { + SchemaProps: spec.SchemaProps{ + Description: "Template is the object that describes the pod that will be created if insufficient replicas are detected. This takes precedence over a TemplateRef. The only allowed template.spec.restartPolicy value is \"Always\". More info: https://kubernetes.io/docs/concepts/workloads/controllers/replicationcontroller#pod-template", + Ref: ref("k8s.io/api/core/v1.PodTemplateSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodTemplateSpec"}, + } +} + +func schema_k8sio_api_core_v1_ReplicationControllerStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReplicationControllerStatus represents the current status of a replication controller.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "replicas": { + SchemaProps: spec.SchemaProps{ + Description: "Replicas is the most recently observed number of replicas. More info: https://kubernetes.io/docs/concepts/workloads/controllers/replicationcontroller#what-is-a-replicationcontroller", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "fullyLabeledReplicas": { + SchemaProps: spec.SchemaProps{ + Description: "The number of pods that have labels matching the labels of the pod template of the replication controller.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "readyReplicas": { + SchemaProps: spec.SchemaProps{ + Description: "The number of ready replicas for this replication controller.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "availableReplicas": { + SchemaProps: spec.SchemaProps{ + Description: "The number of available replicas (ready for at least minReadySeconds) for this replication controller.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "observedGeneration": { + SchemaProps: spec.SchemaProps{ + Description: "ObservedGeneration reflects the generation of the most recently observed replication controller.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Represents the latest available observations of a replication controller's current state.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ReplicationControllerCondition"), + }, + }, + }, + }, + }, + }, + Required: []string{"replicas"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ReplicationControllerCondition"}, + } +} + +func schema_k8sio_api_core_v1_ResourceClaim(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceClaim references one entry in PodSpec.ResourceClaims.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name must match the name of one entry in pod.spec.resourceClaims of the Pod where this field is used. It makes that resource available inside a container.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "request": { + SchemaProps: spec.SchemaProps{ + Description: "Request is the name chosen for a request in the referenced claim. If empty, everything from the claim is made available, otherwise only the result of this request.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ResourceFieldSelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceFieldSelector represents container resources (cpu, memory) and their output format", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "containerName": { + SchemaProps: spec.SchemaProps{ + Description: "Container name: required for volumes, optional for env vars", + Type: []string{"string"}, + Format: "", + }, + }, + "resource": { + SchemaProps: spec.SchemaProps{ + Description: "Required: resource to select", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "divisor": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the output format of the exposed resources, defaults to \"1\"", + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + Required: []string{"resource"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_ResourceHealth(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceHealth represents the health of a resource. It has the latest device health information. This is a part of KEP https://kep.k8s.io/4680.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "resourceID": { + SchemaProps: spec.SchemaProps{ + Description: "ResourceID is the unique identifier of the resource. See the ResourceID type for more information.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "health": { + SchemaProps: spec.SchemaProps{ + Description: "Health of the resource. can be one of:\n - Healthy: operates as normal\n - Unhealthy: reported unhealthy. We consider this a temporary health issue\n since we do not have a mechanism today to distinguish\n temporary and permanent issues.\n - Unknown: The status cannot be determined.\n For example, Device Plugin got unregistered and hasn't been re-registered since.\n\nIn future we may want to introduce the PermanentlyUnhealthy Status.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"resourceID"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ResourceQuota(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceQuota sets aggregate quota restrictions enforced per namespace", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the desired quota. https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceQuotaSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status defines the actual enforced quota and its current usage. https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceQuotaStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ResourceQuotaSpec", "k8s.io/api/core/v1.ResourceQuotaStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ResourceQuotaList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceQuotaList is a list of ResourceQuota items.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "Items is a list of ResourceQuota objects. More info: https://kubernetes.io/docs/concepts/policy/resource-quotas/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceQuota"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ResourceQuota", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceQuotaSpec defines the desired hard limits to enforce for Quota.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "hard": { + SchemaProps: spec.SchemaProps{ + Description: "hard is the set of desired hard limits for each named resource. More info: https://kubernetes.io/docs/concepts/policy/resource-quotas/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "scopes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A collection of filters that must match each object tracked by a quota. If not specified, the quota matches all objects.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, + }, + }, + }, + }, + }, + "scopeSelector": { + SchemaProps: spec.SchemaProps{ + Description: "scopeSelector is also a collection of filters like scopes that must match each object tracked by a quota but expressed using ScopeSelectorOperator in combination with possible values. For a resource to match, both scopes AND scopeSelector (if specified in spec), must be matched.", + Ref: ref("k8s.io/api/core/v1.ScopeSelector"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ScopeSelector", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_ResourceQuotaStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceQuotaStatus defines the enforced hard limits and observed use.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "hard": { + SchemaProps: spec.SchemaProps{ + Description: "Hard is the set of enforced hard limits for each named resource. More info: https://kubernetes.io/docs/concepts/policy/resource-quotas/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "used": { + SchemaProps: spec.SchemaProps{ + Description: "Used is the current observed total usage of the resource in the namespace.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_ResourceRequirements(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceRequirements describes the compute resource requirements.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "limits": { + SchemaProps: spec.SchemaProps{ + Description: "Limits describes the maximum amount of compute resources allowed. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "requests": { + SchemaProps: spec.SchemaProps{ + Description: "Requests describes the minimum amount of compute resources required. If Requests is omitted for a container, it defaults to Limits if that is explicitly specified, otherwise to an implementation-defined value. Requests cannot exceed Limits. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "claims": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Claims lists the names of resources, defined in spec.resourceClaims, that are used by this container.\n\nThis field depends on the DynamicResourceAllocation feature gate.\n\nThis field is immutable. It can only be set for containers.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceClaim"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ResourceClaim", "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_ResourceStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceStatus represents the status of a single resource allocated to a Pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the resource. Must be unique within the pod and in case of non-DRA resource, match one of the resources from the pod spec. For DRA resources, the value must be \"claim:/\". When this status is reported about a container, the \"claim_name\" and \"request\" must match one of the claims of this container.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resources": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "resourceID", + }, + "x-kubernetes-list-type": "map", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of unique resources health. Each element in the list contains an unique resource ID and its health. At a minimum, for the lifetime of a Pod, resource ID must uniquely identify the resource allocated to the Pod on the Node. If other Pod on the same Node reports the status with the same resource ID, it must be the same resource they share. See ResourceID type definition for a specific format it has in various use cases.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceHealth"), + }, + }, + }, + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ResourceHealth"}, + } +} + +func schema_k8sio_api_core_v1_SELinuxOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SELinuxOptions are the labels to be applied to the container", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "user": { + SchemaProps: spec.SchemaProps{ + Description: "User is a SELinux user label that applies to the container.", + Type: []string{"string"}, + Format: "", + }, + }, + "role": { + SchemaProps: spec.SchemaProps{ + Description: "Role is a SELinux role label that applies to the container.", + Type: []string{"string"}, + Format: "", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type is a SELinux type label that applies to the container.", + Type: []string{"string"}, + Format: "", + }, + }, + "level": { + SchemaProps: spec.SchemaProps{ + Description: "Level is SELinux level label that applies to the container.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ScaleIOPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ScaleIOPersistentVolumeSource represents a persistent ScaleIO volume", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "gateway": { + SchemaProps: spec.SchemaProps{ + Description: "gateway is the host address of the ScaleIO API Gateway.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "system": { + SchemaProps: spec.SchemaProps{ + Description: "system is the name of the storage system as configured in ScaleIO.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef references to the secret for ScaleIO user and other sensitive information. If this is not provided, Login operation will fail.", + Ref: ref("k8s.io/api/core/v1.SecretReference"), + }, + }, + "sslEnabled": { + SchemaProps: spec.SchemaProps{ + Description: "sslEnabled is the flag to enable/disable SSL communication with Gateway, default false", + Type: []string{"boolean"}, + Format: "", + }, + }, + "protectionDomain": { + SchemaProps: spec.SchemaProps{ + Description: "protectionDomain is the name of the ScaleIO Protection Domain for the configured storage.", + Type: []string{"string"}, + Format: "", + }, + }, + "storagePool": { + SchemaProps: spec.SchemaProps{ + Description: "storagePool is the ScaleIO Storage Pool associated with the protection domain.", + Type: []string{"string"}, + Format: "", + }, + }, + "storageMode": { + SchemaProps: spec.SchemaProps{ + Description: "storageMode indicates whether the storage for a volume should be ThickProvisioned or ThinProvisioned. Default is ThinProvisioned.", + Default: "ThinProvisioned", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeName is the name of a volume already created in the ScaleIO system that is associated with this volume source.", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Default is \"xfs\"", + Default: "xfs", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"gateway", "system", "secretRef"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SecretReference"}, + } +} + +func schema_k8sio_api_core_v1_ScaleIOVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ScaleIOVolumeSource represents a persistent ScaleIO volume", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "gateway": { + SchemaProps: spec.SchemaProps{ + Description: "gateway is the host address of the ScaleIO API Gateway.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "system": { + SchemaProps: spec.SchemaProps{ + Description: "system is the name of the storage system as configured in ScaleIO.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef references to the secret for ScaleIO user and other sensitive information. If this is not provided, Login operation will fail.", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + "sslEnabled": { + SchemaProps: spec.SchemaProps{ + Description: "sslEnabled Flag enable/disable SSL communication with Gateway, default false", + Type: []string{"boolean"}, + Format: "", + }, + }, + "protectionDomain": { + SchemaProps: spec.SchemaProps{ + Description: "protectionDomain is the name of the ScaleIO Protection Domain for the configured storage.", + Type: []string{"string"}, + Format: "", + }, + }, + "storagePool": { + SchemaProps: spec.SchemaProps{ + Description: "storagePool is the ScaleIO Storage Pool associated with the protection domain.", + Type: []string{"string"}, + Format: "", + }, + }, + "storageMode": { + SchemaProps: spec.SchemaProps{ + Description: "storageMode indicates whether the storage for a volume should be ThickProvisioned or ThinProvisioned. Default is ThinProvisioned.", + Default: "ThinProvisioned", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeName is the name of a volume already created in the ScaleIO system that is associated with this volume source.", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Default is \"xfs\".", + Default: "xfs", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly Defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"gateway", "system", "secretRef"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_ScopeSelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A scope selector represents the AND of the selectors represented by the scoped-resource selector requirements.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "matchExpressions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of scope selector requirements by scope of the resources.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ScopedResourceSelectorRequirement"), + }, + }, + }, + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ScopedResourceSelectorRequirement"}, + } +} + +func schema_k8sio_api_core_v1_ScopedResourceSelectorRequirement(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A scoped-resource selector requirement is a selector that contains values, a scope name, and an operator that relates the scope name and values.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "scopeName": { + SchemaProps: spec.SchemaProps{ + Description: "The name of the scope that the selector applies to.\n\nPossible enum values:\n - `\"BestEffort\"` Match all pod objects that have best effort quality of service\n - `\"CrossNamespacePodAffinity\"` Match all pod objects that have cross-namespace pod (anti)affinity mentioned.\n - `\"NotBestEffort\"` Match all pod objects that do not have best effort quality of service\n - `\"NotTerminating\"` Match all pod objects where spec.activeDeadlineSeconds is nil\n - `\"PriorityClass\"` Match all pod objects that have priority class mentioned\n - `\"Terminating\"` Match all pod objects where spec.activeDeadlineSeconds >=0\n - `\"VolumeAttributesClass\"` Match all pvc objects that have volume attributes class mentioned.", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, + }, + }, + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "Represents a scope's relationship to a set of values. Valid operators are In, NotIn, Exists, DoesNotExist.\n\nPossible enum values:\n - `\"DoesNotExist\"`\n - `\"Exists\"`\n - `\"In\"`\n - `\"NotIn\"`", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"DoesNotExist", "Exists", "In", "NotIn"}, + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "An array of string values. If the operator is In or NotIn, the values array must be non-empty. If the operator is Exists or DoesNotExist, the values array must be empty. This array is replaced during a strategic merge patch.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"scopeName", "operator"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_SeccompProfile(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SeccompProfile defines a pod/container's seccomp profile settings. Only one profile source may be set.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type indicates which kind of seccomp profile will be applied. Valid options are:\n\nLocalhost - a profile defined in a file on the node should be used. RuntimeDefault - the container runtime default profile should be used. Unconfined - no profile should be applied.\n\nPossible enum values:\n - `\"Localhost\"` indicates a profile defined in a file on the node should be used. The file's location relative to /seccomp.\n - `\"RuntimeDefault\"` represents the default container runtime seccomp profile.\n - `\"Unconfined\"` indicates no seccomp profile is applied (A.K.A. unconfined).", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Localhost", "RuntimeDefault", "Unconfined"}, + }, + }, + "localhostProfile": { + SchemaProps: spec.SchemaProps{ + Description: "localhostProfile indicates a profile defined in a file on the node should be used. The profile must be preconfigured on the node to work. Must be a descending path, relative to the kubelet's configured seccomp profile location. Must be set if type is \"Localhost\". Must NOT be set for any other type.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-unions": []interface{}{ + map[string]interface{}{ + "discriminator": "type", + "fields-to-discriminateBy": map[string]interface{}{ + "localhostProfile": "LocalhostProfile", + }, + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Secret(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Secret holds secret data of a certain type. The total bytes of the values in the Data field must be less than MaxSecretSize bytes.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "immutable": { + SchemaProps: spec.SchemaProps{ + Description: "Immutable, if set to true, ensures that data stored in the Secret cannot be updated (only object metadata can be modified). If not set to true, the field can be modified at any time. Defaulted to nil.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "data": { + SchemaProps: spec.SchemaProps{ + Description: "Data contains the secret data. Each key must consist of alphanumeric characters, '-', '_' or '.'. The serialized form of the secret data is a base64 encoded string, representing the arbitrary (possibly non-string) data value here. Described in https://tools.ietf.org/html/rfc4648#section-4", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "byte", + }, + }, + }, + }, + }, + "stringData": { + SchemaProps: spec.SchemaProps{ + Description: "stringData allows specifying non-binary secret data in string form. It is provided as a write-only input field for convenience. All keys and values are merged into the data field on write, overwriting any existing values. The stringData field is never output when reading from the API.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Used to facilitate programmatic handling of secret data. More info: https://kubernetes.io/docs/concepts/configuration/secret/#secret-types", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_SecretEnvSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SecretEnvSource selects a Secret to populate the environment variables with.\n\nThe contents of the target Secret's Data field will represent the key-value pairs as environment variables.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "Specify whether the Secret must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_SecretKeySelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SecretKeySelector selects a key of a Secret.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "key": { + SchemaProps: spec.SchemaProps{ + Description: "The key of the secret to select from. Must be a valid secret key.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "Specify whether the Secret or its key must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"key"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_SecretList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SecretList is a list of Secret.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "Items is a list of secret objects. More info: https://kubernetes.io/docs/concepts/configuration/secret", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Secret"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Secret", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_SecretProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Adapts a secret into a projected volume.\n\nThe contents of the target Secret's Data field will be presented in a projected volume as files using the keys in the Data field as the file names. Note that this is identical to a secret volume source without the default mode.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. This field is effectively required, but due to backwards compatibility is allowed to be empty. Instances of this type with an empty value here are almost certainly wrong. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "items if unspecified, each key-value pair in the Data field of the referenced Secret will be projected into the volume as a file whose name is the key and content is the value. If specified, the listed keys will be projected into the specified paths, and unlisted keys will not be present. If a key is specified which is not present in the Secret, the volume setup will error unless it is marked optional. Paths must be relative and may not contain the '..' path or start with '..'.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.KeyToPath"), + }, + }, + }, + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "optional field specify whether the Secret or its key must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.KeyToPath"}, + } +} + +func schema_k8sio_api_core_v1_SecretReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SecretReference represents a Secret Reference. It has enough information to retrieve secret in any namespace", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name is unique within a namespace to reference a secret resource.", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "namespace defines the space within which the secret name must be unique.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_SecretVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Adapts a Secret into a volume.\n\nThe contents of the target Secret's Data field will be presented in a volume as files using the keys in the Data field as the file names. Secret volumes support ownership management and SELinux relabeling.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "secretName": { + SchemaProps: spec.SchemaProps{ + Description: "secretName is the name of the secret in the pod's namespace to use. More info: https://kubernetes.io/docs/concepts/storage/volumes#secret", + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "items If unspecified, each key-value pair in the Data field of the referenced Secret will be projected into the volume as a file whose name is the key and content is the value. If specified, the listed keys will be projected into the specified paths, and unlisted keys will not be present. If a key is specified which is not present in the Secret, the volume setup will error unless it is marked optional. Paths must be relative and may not contain the '..' path or start with '..'.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.KeyToPath"), + }, + }, + }, + }, + }, + "defaultMode": { + SchemaProps: spec.SchemaProps{ + Description: "defaultMode is Optional: mode bits used to set permissions on created files by default. Must be an octal value between 0000 and 0777 or a decimal value between 0 and 511. YAML accepts both octal and decimal values, JSON requires decimal values for mode bits. Defaults to 0644. Directories within the path are not affected by this setting. This might be in conflict with other options that affect the file mode, like fsGroup, and the result can be other mode bits set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "optional": { + SchemaProps: spec.SchemaProps{ + Description: "optional field specify whether the Secret or its keys must be defined", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.KeyToPath"}, + } +} + +func schema_k8sio_api_core_v1_SecurityContext(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SecurityContext holds security configuration that will be applied to a container. Some fields are present in both SecurityContext and PodSecurityContext. When both are set, the values in SecurityContext take precedence.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "capabilities": { + SchemaProps: spec.SchemaProps{ + Description: "The capabilities to add/drop when running containers. Defaults to the default set of capabilities granted by the container runtime. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.Capabilities"), + }, + }, + "privileged": { + SchemaProps: spec.SchemaProps{ + Description: "Run container in privileged mode. Processes in privileged containers are essentially equivalent to root on the host. Defaults to false. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "seLinuxOptions": { + SchemaProps: spec.SchemaProps{ + Description: "The SELinux context to be applied to the container. If unspecified, the container runtime will allocate a random SELinux context for each container. May also be set in PodSecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.SELinuxOptions"), + }, + }, + "windowsOptions": { + SchemaProps: spec.SchemaProps{ + Description: "The Windows specific settings applied to all containers. If unspecified, the options from the PodSecurityContext will be used. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence. Note that this field cannot be set when spec.os.name is linux.", + Ref: ref("k8s.io/api/core/v1.WindowsSecurityContextOptions"), + }, + }, + "runAsUser": { + SchemaProps: spec.SchemaProps{ + Description: "The UID to run the entrypoint of the container process. Defaults to user specified in image metadata if unspecified. May also be set in PodSecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "runAsGroup": { + SchemaProps: spec.SchemaProps{ + Description: "The GID to run the entrypoint of the container process. Uses runtime default if unset. May also be set in PodSecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "runAsNonRoot": { + SchemaProps: spec.SchemaProps{ + Description: "Indicates that the container must run as a non-root user. If true, the Kubelet will validate the image at runtime to ensure that it does not run as UID 0 (root) and fail to start the container if it does. If unset or false, no such validation will be performed. May also be set in PodSecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "readOnlyRootFilesystem": { + SchemaProps: spec.SchemaProps{ + Description: "Whether this container has a read-only root filesystem. Default is false. Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "allowPrivilegeEscalation": { + SchemaProps: spec.SchemaProps{ + Description: "AllowPrivilegeEscalation controls whether a process can gain more privileges than its parent process. This bool directly controls if the no_new_privs flag will be set on the container process. AllowPrivilegeEscalation is true always when the container is: 1) run as Privileged 2) has CAP_SYS_ADMIN Note that this field cannot be set when spec.os.name is windows.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "procMount": { + SchemaProps: spec.SchemaProps{ + Description: "procMount denotes the type of proc mount to use for the containers. The default value is Default which uses the container runtime defaults for readonly paths and masked paths. This requires the ProcMountType feature flag to be enabled. Note that this field cannot be set when spec.os.name is windows.\n\nPossible enum values:\n - `\"Default\"` uses the container runtime defaults for readonly and masked paths for /proc. Most container runtimes mask certain paths in /proc to avoid accidental security exposure of special devices or information.\n - `\"Unmasked\"` bypasses the default masking behavior of the container runtime and ensures the newly created /proc the container stays in tact with no modifications.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Default", "Unmasked"}, + }, + }, + "seccompProfile": { + SchemaProps: spec.SchemaProps{ + Description: "The seccomp options to use by this container. If seccomp options are provided at both the pod & container level, the container options override the pod options. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.SeccompProfile"), + }, + }, + "appArmorProfile": { + SchemaProps: spec.SchemaProps{ + Description: "appArmorProfile is the AppArmor options to use by this container. If set, this profile overrides the pod's appArmorProfile. Note that this field cannot be set when spec.os.name is windows.", + Ref: ref("k8s.io/api/core/v1.AppArmorProfile"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AppArmorProfile", "k8s.io/api/core/v1.Capabilities", "k8s.io/api/core/v1.SELinuxOptions", "k8s.io/api/core/v1.SeccompProfile", "k8s.io/api/core/v1.WindowsSecurityContextOptions"}, + } +} + +func schema_k8sio_api_core_v1_SerializedReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SerializedReference is a reference to serialized object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "reference": { + SchemaProps: spec.SchemaProps{ + Description: "The reference to an object in the system.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_Service(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Service is a named abstraction of software service (for example, mysql) consisting of local port (for example 3306) that the proxy listens on, and the selector that determines which pods will answer requests sent through the proxy.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the behavior of a service. https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ServiceSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Most recently observed status of the service. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ServiceStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ServiceSpec", "k8s.io/api/core/v1.ServiceStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ServiceAccount(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccount binds together: * a name, understood by users, and perhaps by peripheral systems, for an identity * a principal that can be authenticated and authorized * a set of secrets", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + "secrets": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "name", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Secrets is a list of the secrets in the same namespace that pods running using this ServiceAccount are allowed to use. Pods are only limited to this list if this service account has a \"kubernetes.io/enforce-mountable-secrets\" annotation set to \"true\". The \"kubernetes.io/enforce-mountable-secrets\" annotation is deprecated since v1.32. Prefer separate namespaces to isolate access to mounted secrets. This field should not be used to find auto-generated service account token secrets for use outside of pods. Instead, tokens can be requested directly using the TokenRequest API, or service account token secrets can be manually created. More info: https://kubernetes.io/docs/concepts/configuration/secret", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + }, + }, + }, + "imagePullSecrets": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ImagePullSecrets is a list of references to secrets in the same namespace to use for pulling any images in pods that reference this ServiceAccount. ImagePullSecrets are distinct from Secrets because Secrets can be mounted in the pod, but ImagePullSecrets are only accessed by the kubelet. More info: https://kubernetes.io/docs/concepts/containers/images/#specifying-imagepullsecrets-on-a-pod", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + "automountServiceAccountToken": { + SchemaProps: spec.SchemaProps{ + Description: "AutomountServiceAccountToken indicates whether pods running as this service account should have an API token automatically mounted. Can be overridden at the pod level.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/api/core/v1.ObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_k8sio_api_core_v1_ServiceAccountList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountList is a list of ServiceAccount objects", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of ServiceAccounts. More info: https://kubernetes.io/docs/tasks/configure-pod-container/configure-service-account/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ServiceAccount"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ServiceAccount", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ServiceAccountTokenProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountTokenProjection represents a projected service account token volume. This projection can be used to insert a service account token into the pods runtime filesystem for use against APIs (Kubernetes API Server or otherwise).", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "audience": { + SchemaProps: spec.SchemaProps{ + Description: "audience is the intended audience of the token. A recipient of a token must identify itself with an identifier specified in the audience of the token, and otherwise should reject the token. The audience defaults to the identifier of the apiserver.", + Type: []string{"string"}, + Format: "", + }, + }, + "expirationSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "expirationSeconds is the requested duration of validity of the service account token. As the token approaches expiration, the kubelet volume plugin will proactively rotate the service account token. The kubelet will start trying to rotate the token if the token is older than 80 percent of its time to live or if the token is older than 24 hours.Defaults to 1 hour and must be at least 10 minutes.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "path is the path relative to the mount point of the file to project the token into.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"path"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ServiceList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceList holds a list of services.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of services", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Service"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Service", "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"}, + } +} + +func schema_k8sio_api_core_v1_ServicePort(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServicePort contains information on service's port.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The name of this port within the service. This must be a DNS_LABEL. All ports within a ServiceSpec must have unique names. When considering the endpoints for a Service, this must match the 'name' field in the EndpointPort. Optional if only one ServicePort is defined on this service.", + Type: []string{"string"}, + Format: "", + }, + }, + "protocol": { + SchemaProps: spec.SchemaProps{ + Description: "The IP protocol for this port. Supports \"TCP\", \"UDP\", and \"SCTP\". Default is TCP.\n\nPossible enum values:\n - `\"SCTP\"` is the SCTP protocol.\n - `\"TCP\"` is the TCP protocol.\n - `\"UDP\"` is the UDP protocol.", + Default: "TCP", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"SCTP", "TCP", "UDP"}, + }, + }, + "appProtocol": { + SchemaProps: spec.SchemaProps{ + Description: "The application protocol for this port. This is used as a hint for implementations to offer richer behavior for protocols that they understand. This field follows standard Kubernetes label syntax. Valid values are either:\n\n* Un-prefixed protocol names - reserved for IANA standard service names (as per RFC-6335 and https://www.iana.org/assignments/service-names).\n\n* Kubernetes-defined prefixed names:\n * 'kubernetes.io/h2c' - HTTP/2 prior knowledge over cleartext as described in https://www.rfc-editor.org/rfc/rfc9113.html#name-starting-http-2-with-prior-\n * 'kubernetes.io/ws' - WebSocket over cleartext as described in https://www.rfc-editor.org/rfc/rfc6455\n * 'kubernetes.io/wss' - WebSocket over TLS as described in https://www.rfc-editor.org/rfc/rfc6455\n\n* Other protocols should use implementation-defined prefixed names such as mycompany.com/my-custom-protocol.", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Description: "The port that will be exposed by this service.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "targetPort": { + SchemaProps: spec.SchemaProps{ + Description: "Number or name of the port to access on the pods targeted by the service. Number must be in the range 1 to 65535. Name must be an IANA_SVC_NAME. If this is a string, it will be looked up as a named port in the target Pod's container ports. If this is not specified, the value of the 'port' field is used (an identity map). This field is ignored for services with clusterIP=None, and should be omitted or set equal to the 'port' field. More info: https://kubernetes.io/docs/concepts/services-networking/service/#defining-a-service", + Ref: ref("k8s.io/apimachinery/pkg/util/intstr.IntOrString"), + }, + }, + "nodePort": { + SchemaProps: spec.SchemaProps{ + Description: "The port on each node on which this service is exposed when type is NodePort or LoadBalancer. Usually assigned by the system. If a value is specified, in-range, and not in use it will be used, otherwise the operation will fail. If not specified, a port will be allocated if this Service requires one. If this field is specified when creating a Service which does not need it, creation will fail. This field will be wiped when updating a Service to no longer need it (e.g. changing type from NodePort to ClusterIP). More info: https://kubernetes.io/docs/concepts/services-networking/service/#type-nodeport", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"port"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/util/intstr.IntOrString"}, + } +} + +func schema_k8sio_api_core_v1_ServiceProxyOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceProxyOptions is the query options to a Service's proxy call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "path": { + SchemaProps: spec.SchemaProps{ + Description: "Path is the part of URLs that include service endpoints, suffixes, and parameters to use for the current proxy request to service. For example, the whole request URL is http://localhost/api/v1/namespaces/kube-system/services/elasticsearch-logging/_search?q=user:kimchy. Path is _search?q=user:kimchy.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceSpec describes the attributes that a user creates on a service.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "port", + "protocol", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "port", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The list of ports that are exposed by this service. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ServicePort"), + }, + }, + }, + }, + }, + "selector": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Route service traffic to pods with label keys and values matching this selector. If empty or not present, the service is assumed to have an external process managing its endpoints, which Kubernetes will not modify. Only applies to types ClusterIP, NodePort, and LoadBalancer. Ignored if type is ExternalName. More info: https://kubernetes.io/docs/concepts/services-networking/service/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "clusterIP": { + SchemaProps: spec.SchemaProps{ + Description: "clusterIP is the IP address of the service and is usually assigned randomly. If an address is specified manually, is in-range (as per system configuration), and is not in use, it will be allocated to the service; otherwise creation of the service will fail. This field may not be changed through updates unless the type field is also being changed to ExternalName (which requires this field to be blank) or the type field is being changed from ExternalName (in which case this field may optionally be specified, as describe above). Valid values are \"None\", empty string (\"\"), or a valid IP address. Setting this to \"None\" makes a \"headless service\" (no virtual IP), which is useful when direct endpoint connections are preferred and proxying is not required. Only applies to types ClusterIP, NodePort, and LoadBalancer. If this field is specified when creating a Service of type ExternalName, creation will fail. This field will be wiped when updating a Service to type ExternalName. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies", + Type: []string{"string"}, + Format: "", + }, + }, + "clusterIPs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ClusterIPs is a list of IP addresses assigned to this service, and are usually assigned randomly. If an address is specified manually, is in-range (as per system configuration), and is not in use, it will be allocated to the service; otherwise creation of the service will fail. This field may not be changed through updates unless the type field is also being changed to ExternalName (which requires this field to be empty) or the type field is being changed from ExternalName (in which case this field may optionally be specified, as describe above). Valid values are \"None\", empty string (\"\"), or a valid IP address. Setting this to \"None\" makes a \"headless service\" (no virtual IP), which is useful when direct endpoint connections are preferred and proxying is not required. Only applies to types ClusterIP, NodePort, and LoadBalancer. If this field is specified when creating a Service of type ExternalName, creation will fail. This field will be wiped when updating a Service to type ExternalName. If this field is not specified, it will be initialized from the clusterIP field. If this field is specified, clients must ensure that clusterIPs[0] and clusterIP have the same value.\n\nThis field may hold a maximum of two entries (dual-stack IPs, in either order). These IPs must correspond to the values of the ipFamilies field. Both clusterIPs and ipFamilies are governed by the ipFamilyPolicy field. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type determines how the Service is exposed. Defaults to ClusterIP. Valid options are ExternalName, ClusterIP, NodePort, and LoadBalancer. \"ClusterIP\" allocates a cluster-internal IP address for load-balancing to endpoints. Endpoints are determined by the selector or if that is not specified, by manual construction of an Endpoints object or EndpointSlice objects. If clusterIP is \"None\", no virtual IP is allocated and the endpoints are published as a set of endpoints rather than a virtual IP. \"NodePort\" builds on ClusterIP and allocates a port on every node which routes to the same endpoints as the clusterIP. \"LoadBalancer\" builds on NodePort and creates an external load-balancer (if supported in the current cloud) which routes to the same endpoints as the clusterIP. \"ExternalName\" aliases this service to the specified externalName. Several other fields do not apply to ExternalName services. More info: https://kubernetes.io/docs/concepts/services-networking/service/#publishing-services-service-types\n\nPossible enum values:\n - `\"ClusterIP\"` means a service will only be accessible inside the cluster, via the cluster IP.\n - `\"ExternalName\"` means a service consists of only a reference to an external name that kubedns or equivalent will return as a CNAME record, with no exposing or proxying of any pods involved.\n - `\"LoadBalancer\"` means a service will be exposed via an external load balancer (if the cloud provider supports it), in addition to 'NodePort' type.\n - `\"NodePort\"` means a service will be exposed on one port of every node, in addition to 'ClusterIP' type.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ClusterIP", "ExternalName", "LoadBalancer", "NodePort"}, + }, + }, + "externalIPs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "externalIPs is a list of IP addresses for which nodes in the cluster will also accept traffic for this service. These IPs are not managed by Kubernetes. The user is responsible for ensuring that traffic arrives at a node with this IP. A common example is external load-balancers that are not part of the Kubernetes system.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "sessionAffinity": { + SchemaProps: spec.SchemaProps{ + Description: "Supports \"ClientIP\" and \"None\". Used to maintain session affinity. Enable client IP based session affinity. Must be ClientIP or None. Defaults to None. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies\n\nPossible enum values:\n - `\"ClientIP\"` is the Client IP based.\n - `\"None\"` - no session affinity.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ClientIP", "None"}, + }, + }, + "loadBalancerIP": { + SchemaProps: spec.SchemaProps{ + Description: "Only applies to Service Type: LoadBalancer. This feature depends on whether the underlying cloud-provider supports specifying the loadBalancerIP when a load balancer is created. This field will be ignored if the cloud-provider does not support the feature. Deprecated: This field was under-specified and its meaning varies across implementations. Using it is non-portable and it may not support dual-stack. Users are encouraged to use implementation-specific annotations when available.", + Type: []string{"string"}, + Format: "", + }, + }, + "loadBalancerSourceRanges": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "If specified and supported by the platform, this will restrict traffic through the cloud-provider load-balancer will be restricted to the specified client IPs. This field will be ignored if the cloud-provider does not support the feature.\" More info: https://kubernetes.io/docs/tasks/access-application-cluster/create-external-load-balancer/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "externalName": { + SchemaProps: spec.SchemaProps{ + Description: "externalName is the external reference that discovery mechanisms will return as an alias for this service (e.g. a DNS CNAME record). No proxying will be involved. Must be a lowercase RFC-1123 hostname (https://tools.ietf.org/html/rfc1123) and requires `type` to be \"ExternalName\".", + Type: []string{"string"}, + Format: "", + }, + }, + "externalTrafficPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Cluster", "Local"}, + }, + }, + "healthCheckNodePort": { + SchemaProps: spec.SchemaProps{ + Description: "healthCheckNodePort specifies the healthcheck nodePort for the service. This only applies when type is set to LoadBalancer and externalTrafficPolicy is set to Local. If a value is specified, is in-range, and is not in use, it will be used. If not specified, a value will be automatically allocated. External systems (e.g. load-balancers) can use this port to determine if a given node holds endpoints for this service or not. If this field is specified when creating a Service which does not need it, creation will fail. This field will be wiped when updating a Service to no longer need it (e.g. changing type). This field cannot be updated once set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "publishNotReadyAddresses": { + SchemaProps: spec.SchemaProps{ + Description: "publishNotReadyAddresses indicates that any agent which deals with endpoints for this Service should disregard any indications of ready/not-ready. The primary use case for setting this field is for a StatefulSet's Headless Service to propagate SRV DNS records for its Pods for the purpose of peer discovery. The Kubernetes controllers that generate Endpoints and EndpointSlice resources for Services interpret this to mean that all endpoints are considered \"ready\" even if the Pods themselves are not. Agents which consume only Kubernetes generated endpoints through the Endpoints or EndpointSlice resources can safely assume this behavior.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "sessionAffinityConfig": { + SchemaProps: spec.SchemaProps{ + Description: "sessionAffinityConfig contains the configurations of session affinity.", + Ref: ref("k8s.io/api/core/v1.SessionAffinityConfig"), + }, + }, + "ipFamilies": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "IPFamilies is a list of IP families (e.g. IPv4, IPv6) assigned to this service. This field is usually assigned automatically based on cluster configuration and the ipFamilyPolicy field. If this field is specified manually, the requested family is available in the cluster, and ipFamilyPolicy allows it, it will be used; otherwise creation of the service will fail. This field is conditionally mutable: it allows for adding or removing a secondary IP family, but it does not allow changing the primary IP family of the Service. Valid values are \"IPv4\" and \"IPv6\". This field only applies to Services of types ClusterIP, NodePort, and LoadBalancer, and does apply to \"headless\" services. This field will be wiped when updating a Service to type ExternalName.\n\nThis field may hold a maximum of two entries (dual-stack families, in either order). These families must correspond to the values of the clusterIPs field, if specified. Both clusterIPs and ipFamilies are governed by the ipFamilyPolicy field.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, + }, + }, + }, + }, + }, + "ipFamilyPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "IPFamilyPolicy represents the dual-stack-ness requested or required by this Service. If there is no value provided, then this field will be set to SingleStack. Services can be \"SingleStack\" (a single IP family), \"PreferDualStack\" (two IP families on dual-stack configured clusters or a single IP family on single-stack clusters), or \"RequireDualStack\" (two IP families on dual-stack configured clusters, otherwise fail). The ipFamilies and clusterIPs fields depend on the value of this field. This field will be wiped when updating a service to type ExternalName.\n\nPossible enum values:\n - `\"PreferDualStack\"` indicates that this service prefers dual-stack when the cluster is configured for dual-stack. If the cluster is not configured for dual-stack the service will be assigned a single IPFamily. If the IPFamily is not set in service.spec.ipFamilies then the service will be assigned the default IPFamily configured on the cluster\n - `\"RequireDualStack\"` indicates that this service requires dual-stack. Using IPFamilyPolicyRequireDualStack on a single stack cluster will result in validation errors. The IPFamilies (and their order) assigned to this service is based on service.spec.ipFamilies. If service.spec.ipFamilies was not provided then it will be assigned according to how they are configured on the cluster. If service.spec.ipFamilies has only one entry then the alternative IPFamily will be added by apiserver\n - `\"SingleStack\"` indicates that this service is required to have a single IPFamily. The IPFamily assigned is based on the default IPFamily used by the cluster or as identified by service.spec.ipFamilies field", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"PreferDualStack", "RequireDualStack", "SingleStack"}, + }, + }, + "allocateLoadBalancerNodePorts": { + SchemaProps: spec.SchemaProps{ + Description: "allocateLoadBalancerNodePorts defines if NodePorts will be automatically allocated for services with type LoadBalancer. Default is \"true\". It may be set to \"false\" if the cluster load-balancer does not rely on NodePorts. If the caller requests specific NodePorts (by specifying a value), those requests will be respected, regardless of this field. This field may only be set for services with type LoadBalancer and will be cleared if the type is changed to any other type.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "loadBalancerClass": { + SchemaProps: spec.SchemaProps{ + Description: "loadBalancerClass is the class of the load balancer implementation this Service belongs to. If specified, the value of this field must be a label-style identifier, with an optional prefix, e.g. \"internal-vip\" or \"example.com/internal-vip\". Unprefixed names are reserved for end-users. This field can only be set when the Service type is 'LoadBalancer'. If not set, the default load balancer implementation is used, today this is typically done through the cloud provider integration, but should apply for any default implementation. If set, it is assumed that a load balancer implementation is watching for Services with a matching class. Any default load balancer implementation (e.g. cloud providers) should ignore Services that set this field. This field can only be set when creating or updating a Service to type 'LoadBalancer'. Once set, it can not be changed. This field will be wiped when a service is updated to a non 'LoadBalancer' type.", + Type: []string{"string"}, + Format: "", + }, + }, + "internalTrafficPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "InternalTrafficPolicy describes how nodes distribute service traffic they receive on the ClusterIP. If set to \"Local\", the proxy will assume that pods only want to talk to endpoints of the service on the same node as the pod, dropping the traffic if there are no local endpoints. The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features).\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` routes traffic only to endpoints on the same node as the client pod (dropping the traffic if there are no local endpoints).", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Cluster", "Local"}, + }, + }, + "trafficDistribution": { + SchemaProps: spec.SchemaProps{ + Description: "TrafficDistribution offers a way to express preferences for how traffic is distributed to Service endpoints. Implementations can use this field as a hint, but are not required to guarantee strict adherence. If the field is not set, the implementation will apply its default routing strategy. If set to \"PreferClose\", implementations should prioritize endpoints that are in the same zone.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ServicePort", "k8s.io/api/core/v1.SessionAffinityConfig"}, + } +} + +func schema_k8sio_api_core_v1_ServiceStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceStatus represents the current status of a service.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "loadBalancer": { + SchemaProps: spec.SchemaProps{ + Description: "LoadBalancer contains the current status of the load-balancer, if one is present.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LoadBalancerStatus"), + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "type", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "type", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Current service state", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Condition"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LoadBalancerStatus", "k8s.io/apimachinery/pkg/apis/meta/v1.Condition"}, + } +} + +func schema_k8sio_api_core_v1_SessionAffinityConfig(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SessionAffinityConfig represents the configurations of session affinity.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "clientIP": { + SchemaProps: spec.SchemaProps{ + Description: "clientIP contains the configurations of Client IP based session affinity.", + Ref: ref("k8s.io/api/core/v1.ClientIPConfig"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ClientIPConfig"}, + } +} + +func schema_k8sio_api_core_v1_SleepAction(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "SleepAction describes a \"sleep\" action.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "seconds": { + SchemaProps: spec.SchemaProps{ + Description: "Seconds is the number of seconds to sleep.", + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + Required: []string{"seconds"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_StorageOSPersistentVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a StorageOS persistent volume resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeName is the human-readable name of the StorageOS volume. Volume names are only unique within a namespace.", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "volumeNamespace specifies the scope of the volume within StorageOS. If no namespace is specified then the Pod's namespace will be used. This allows the Kubernetes name scoping to be mirrored within StorageOS for tighter integration. Set VolumeName to any name to override the default behaviour. Set to \"default\" if you are not using namespaces within StorageOS. Namespaces that do not pre-exist within StorageOS will be created.", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef specifies the secret to use for obtaining the StorageOS API credentials. If not specified, default values will be attempted.", + Ref: ref("k8s.io/api/core/v1.ObjectReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_StorageOSVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a StorageOS persistent volume resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeName": { + SchemaProps: spec.SchemaProps{ + Description: "volumeName is the human-readable name of the StorageOS volume. Volume names are only unique within a namespace.", + Type: []string{"string"}, + Format: "", + }, + }, + "volumeNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "volumeNamespace specifies the scope of the volume within StorageOS. If no namespace is specified then the Pod's namespace will be used. This allows the Kubernetes name scoping to be mirrored within StorageOS for tighter integration. Set VolumeName to any name to override the default behaviour. Set to \"default\" if you are not using namespaces within StorageOS. Namespaces that do not pre-exist within StorageOS will be created.", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is the filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "readOnly defaults to false (read/write). ReadOnly here will force the ReadOnly setting in VolumeMounts.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "secretRef": { + SchemaProps: spec.SchemaProps{ + Description: "secretRef specifies the secret to use for obtaining the StorageOS API credentials. If not specified, default values will be attempted.", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_k8sio_api_core_v1_Sysctl(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Sysctl defines a kernel parameter to be set", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of a property to set", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "Value of a property to set", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "value"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_TCPSocketAction(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TCPSocketAction describes an action based on opening a socket", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "port": { + SchemaProps: spec.SchemaProps{ + Description: "Number or name of the port to access on the container. Number must be in the range 1 to 65535. Name must be an IANA_SVC_NAME.", + Ref: ref("k8s.io/apimachinery/pkg/util/intstr.IntOrString"), + }, + }, + "host": { + SchemaProps: spec.SchemaProps{ + Description: "Optional: Host name to connect to, defaults to the pod IP.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"port"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/util/intstr.IntOrString"}, + } +} + +func schema_k8sio_api_core_v1_Taint(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "The node this Taint is attached to has the \"effect\" on any pod that does not tolerate the Taint.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "Required. The taint key to be applied to a node.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "The taint value corresponding to the taint key.", + Type: []string{"string"}, + Format: "", + }, + }, + "effect": { + SchemaProps: spec.SchemaProps{ + Description: "Required. The effect of the taint on pods that do not tolerate the taint. Valid effects are NoSchedule, PreferNoSchedule and NoExecute.\n\nPossible enum values:\n - `\"NoExecute\"` Evict any already-running pods that do not tolerate the taint. Currently enforced by NodeController.\n - `\"NoSchedule\"` Do not allow new pods to schedule onto the node unless they tolerate the taint, but allow all pods submitted to Kubelet without going through the scheduler to start, and allow all already-running pods to continue running. Enforced by the scheduler.\n - `\"PreferNoSchedule\"` Like TaintEffectNoSchedule, but the scheduler tries not to schedule new pods onto the node, rather than prohibiting new pods from scheduling onto the node entirely. Enforced by the scheduler.", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"NoExecute", "NoSchedule", "PreferNoSchedule"}, + }, + }, + "timeAdded": { + SchemaProps: spec.SchemaProps{ + Description: "TimeAdded represents the time at which the taint was added.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + }, + Required: []string{"key", "effect"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_k8sio_api_core_v1_Toleration(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "The pod this Toleration is attached to tolerates any taint that matches the triple using the matching operator .", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "Key is the taint key that the toleration applies to. Empty means match all taint keys. If the key is empty, operator must be Exists; this combination means to match all values and all keys.", + Type: []string{"string"}, + Format: "", + }, + }, + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "Operator represents a key's relationship to the value. Valid operators are Exists and Equal. Defaults to Equal. Exists is equivalent to wildcard for value, so that a pod can tolerate all taints of a particular category.\n\nPossible enum values:\n - `\"Equal\"`\n - `\"Exists\"`", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Equal", "Exists"}, + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Description: "Value is the taint value the toleration matches to. If the operator is Exists, the value should be empty, otherwise just a regular string.", + Type: []string{"string"}, + Format: "", + }, + }, + "effect": { + SchemaProps: spec.SchemaProps{ + Description: "Effect indicates the taint effect to match. Empty means match all taint effects. When specified, allowed values are NoSchedule, PreferNoSchedule and NoExecute.\n\nPossible enum values:\n - `\"NoExecute\"` Evict any already-running pods that do not tolerate the taint. Currently enforced by NodeController.\n - `\"NoSchedule\"` Do not allow new pods to schedule onto the node unless they tolerate the taint, but allow all pods submitted to Kubelet without going through the scheduler to start, and allow all already-running pods to continue running. Enforced by the scheduler.\n - `\"PreferNoSchedule\"` Like TaintEffectNoSchedule, but the scheduler tries not to schedule new pods onto the node, rather than prohibiting new pods from scheduling onto the node entirely. Enforced by the scheduler.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"NoExecute", "NoSchedule", "PreferNoSchedule"}, + }, + }, + "tolerationSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "TolerationSeconds represents the period of time the toleration (which must be of effect NoExecute, otherwise this field is ignored) tolerates the taint. By default, it is not set, which means tolerate the taint forever (do not evict). Zero and negative values will be treated as 0 (evict immediately) by the system.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_TopologySelectorLabelRequirement(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A topology selector requirement is a selector that matches given label. This is an alpha feature and may change in the future.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "The label key that the selector applies to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "An array of string values. One value must match the label to be selected. Each entry in Values is ORed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"key", "values"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_TopologySelectorTerm(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A topology selector term represents the result of label queries. A null or empty topology selector term matches no objects. The requirements of them are ANDed. It provides a subset of functionality as NodeSelectorTerm. This is an alpha feature and may change in the future.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "matchLabelExpressions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "A list of topology selector requirements by labels.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.TopologySelectorLabelRequirement"), + }, + }, + }, + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.TopologySelectorLabelRequirement"}, + } +} + +func schema_k8sio_api_core_v1_TopologySpreadConstraint(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TopologySpreadConstraint specifies how to spread matching pods among the given topology.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "maxSkew": { + SchemaProps: spec.SchemaProps{ + Description: "MaxSkew describes the degree to which pods may be unevenly distributed. When `whenUnsatisfiable=DoNotSchedule`, it is the maximum permitted difference between the number of matching pods in the target topology and the global minimum. The global minimum is the minimum number of matching pods in an eligible domain or zero if the number of eligible domains is less than MinDomains. For example, in a 3-zone cluster, MaxSkew is set to 1, and pods with the same labelSelector spread as 2/2/1: In this case, the global minimum is 1. | zone1 | zone2 | zone3 | | P P | P P | P | - if MaxSkew is 1, incoming pod can only be scheduled to zone3 to become 2/2/2; scheduling it onto zone1(zone2) would make the ActualSkew(3-1) on zone1(zone2) violate MaxSkew(1). - if MaxSkew is 2, incoming pod can be scheduled onto any zone. When `whenUnsatisfiable=ScheduleAnyway`, it is used to give higher precedence to topologies that satisfy it. It's a required field. Default value is 1 and 0 is not allowed.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "topologyKey": { + SchemaProps: spec.SchemaProps{ + Description: "TopologyKey is the key of node labels. Nodes that have a label with this key and identical values are considered to be in the same topology. We consider each as a \"bucket\", and try to put balanced number of pods into each bucket. We define a domain as a particular instance of a topology. Also, we define an eligible domain as a domain whose nodes meet the requirements of nodeAffinityPolicy and nodeTaintsPolicy. e.g. If TopologyKey is \"kubernetes.io/hostname\", each Node is a domain of that topology. And, if TopologyKey is \"topology.kubernetes.io/zone\", each zone is a domain of that topology. It's a required field.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "whenUnsatisfiable": { + SchemaProps: spec.SchemaProps{ + Description: "WhenUnsatisfiable indicates how to deal with a pod if it doesn't satisfy the spread constraint. - DoNotSchedule (default) tells the scheduler not to schedule it. - ScheduleAnyway tells the scheduler to schedule the pod in any location,\n but giving higher precedence to topologies that would help reduce the\n skew.\nA constraint is considered \"Unsatisfiable\" for an incoming pod if and only if every possible node assignment for that pod would violate \"MaxSkew\" on some topology. For example, in a 3-zone cluster, MaxSkew is set to 1, and pods with the same labelSelector spread as 3/1/1: | zone1 | zone2 | zone3 | | P P P | P | P | If WhenUnsatisfiable is set to DoNotSchedule, incoming pod can only be scheduled to zone2(zone3) to become 3/2/1(3/1/2) as ActualSkew(2-1) on zone2(zone3) satisfies MaxSkew(1). In other words, the cluster can still be imbalanced, but scheduler won't make it *more* imbalanced. It's a required field.\n\nPossible enum values:\n - `\"DoNotSchedule\"` instructs the scheduler not to schedule the pod when constraints are not satisfied.\n - `\"ScheduleAnyway\"` instructs the scheduler to schedule the pod even if constraints are not satisfied.", + Default: "", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"DoNotSchedule", "ScheduleAnyway"}, + }, + }, + "labelSelector": { + SchemaProps: spec.SchemaProps{ + Description: "LabelSelector is used to find matching pods. Pods that match this label selector are counted to determine the number of pods in their corresponding topology domain.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"), + }, + }, + "minDomains": { + SchemaProps: spec.SchemaProps{ + Description: "MinDomains indicates a minimum number of eligible domains. When the number of eligible domains with matching topology keys is less than minDomains, Pod Topology Spread treats \"global minimum\" as 0, and then the calculation of Skew is performed. And when the number of eligible domains with matching topology keys equals or greater than minDomains, this value has no effect on scheduling. As a result, when the number of eligible domains is less than minDomains, scheduler won't schedule more than maxSkew Pods to those domains. If value is nil, the constraint behaves as if MinDomains is equal to 1. Valid values are integers greater than 0. When value is not nil, WhenUnsatisfiable must be DoNotSchedule.\n\nFor example, in a 3-zone cluster, MaxSkew is set to 2, MinDomains is set to 5 and pods with the same labelSelector spread as 2/2/2: | zone1 | zone2 | zone3 | | P P | P P | P P | The number of domains is less than 5(MinDomains), so \"global minimum\" is treated as 0. In this situation, new pod with the same labelSelector cannot be scheduled, because computed skew will be 3(3 - 0) if new Pod is scheduled to any of the three zones, it will violate MaxSkew.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "nodeAffinityPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "NodeAffinityPolicy indicates how we will treat Pod's nodeAffinity/nodeSelector when calculating pod topology spread skew. Options are: - Honor: only nodes matching nodeAffinity/nodeSelector are included in the calculations. - Ignore: nodeAffinity/nodeSelector are ignored. All nodes are included in the calculations.\n\nIf this value is nil, the behavior is equivalent to the Honor policy.\n\nPossible enum values:\n - `\"Honor\"` means use this scheduling directive when calculating pod topology spread skew.\n - `\"Ignore\"` means ignore this scheduling directive when calculating pod topology spread skew.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Honor", "Ignore"}, + }, + }, + "nodeTaintsPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "NodeTaintsPolicy indicates how we will treat node taints when calculating pod topology spread skew. Options are: - Honor: nodes without taints, along with tainted nodes for which the incoming pod has a toleration, are included. - Ignore: node taints are ignored. All nodes are included.\n\nIf this value is nil, the behavior is equivalent to the Ignore policy.\n\nPossible enum values:\n - `\"Honor\"` means use this scheduling directive when calculating pod topology spread skew.\n - `\"Ignore\"` means ignore this scheduling directive when calculating pod topology spread skew.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Honor", "Ignore"}, + }, + }, + "matchLabelKeys": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "MatchLabelKeys is a set of pod label keys to select the pods over which spreading will be calculated. The keys are used to lookup values from the incoming pod labels, those key-value labels are ANDed with labelSelector to select the group of existing pods over which spreading will be calculated for the incoming pod. The same key is forbidden to exist in both MatchLabelKeys and LabelSelector. MatchLabelKeys cannot be set when LabelSelector isn't set. Keys that don't exist in the incoming pod labels will be ignored. A null or empty list means only match against labelSelector.\n\nThis is a beta field and requires the MatchLabelKeysInPodTopologySpread feature gate to be enabled (enabled by default).", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"maxSkew", "topologyKey", "whenUnsatisfiable"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelector"}, + } +} + +func schema_k8sio_api_core_v1_TypedLocalObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypedLocalObjectReference contains enough information to let you locate the typed referenced object inside the same namespace.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiGroup": { + SchemaProps: spec.SchemaProps{ + Description: "APIGroup is the group for the resource being referenced. If APIGroup is not specified, the specified Kind must be in the core API group. For any other third-party types, APIGroup is required.", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is the type of resource being referenced", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is the name of resource being referenced", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"kind", "name"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_k8sio_api_core_v1_TypedObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypedObjectReference contains enough information to let you locate the typed referenced object", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiGroup": { + SchemaProps: spec.SchemaProps{ + Description: "APIGroup is the group for the resource being referenced. If APIGroup is not specified, the specified Kind must be in the core API group. For any other third-party types, APIGroup is required.", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is the type of resource being referenced", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is the name of resource being referenced", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace is the namespace of resource being referenced Note that when a namespace is specified, a gateway.networking.k8s.io/ReferenceGrant object is required in the referent namespace to allow that namespace's owner to accept the reference. See the ReferenceGrant documentation for details. (Alpha) This field requires the CrossNamespaceVolumeDataSource feature gate to be enabled.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"kind", "name"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_Volume(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Volume represents a named volume in a pod that may be accessed by any container in the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name of the volume. Must be a DNS_LABEL and unique within the pod. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a pre-existing file or directory on the host machine that is directly exposed to the container. This is generally used for system agents or other privileged things that are allowed to see the host machine. Most containers will NOT need this. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "emptyDir": { + SchemaProps: spec.SchemaProps{ + Description: "emptyDir represents a temporary directory that shares a pod's lifetime. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Ref: ref("k8s.io/api/core/v1.EmptyDirVolumeSource"), + }, + }, + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: GCEPersistentDisk is deprecated. All operations for the in-tree gcePersistentDisk type are redirected to the pd.csi.storage.gke.io CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: AWSElasticBlockStore is deprecated. All operations for the in-tree awsElasticBlockStore type are redirected to the ebs.csi.aws.com CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "gitRepo": { + SchemaProps: spec.SchemaProps{ + Description: "gitRepo represents a git repository at a particular revision. Deprecated: GitRepo is deprecated. To provision a container with a git repo, mount an EmptyDir into an InitContainer that clones the repo using git, then mount the EmptyDir into the Pod's container.", + Ref: ref("k8s.io/api/core/v1.GitRepoVolumeSource"), + }, + }, + "secret": { + SchemaProps: spec.SchemaProps{ + Description: "secret represents a secret that should populate this volume. More info: https://kubernetes.io/docs/concepts/storage/volumes#secret", + Ref: ref("k8s.io/api/core/v1.SecretVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host that shares a pod's lifetime More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes/#iscsi", + Ref: ref("k8s.io/api/core/v1.ISCSIVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs mount on the host that shares a pod's lifetime. Deprecated: Glusterfs is deprecated and the in-tree glusterfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.GlusterfsVolumeSource"), + }, + }, + "persistentVolumeClaim": { + SchemaProps: spec.SchemaProps{ + Description: "persistentVolumeClaimVolumeSource represents a reference to a PersistentVolumeClaim in the same namespace. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. Deprecated: RBD is deprecated and the in-tree rbd type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.RBDVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin. Deprecated: FlexVolume is deprecated. Consider using a CSIDriver instead.", + Ref: ref("k8s.io/api/core/v1.FlexVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. Deprecated: Cinder is deprecated. All operations for the in-tree cinder type are redirected to the cinder.csi.openstack.org CSI driver. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime. Deprecated: CephFS is deprecated and the in-tree cephfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.CephFSVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine. This depends on the Flocker control service being running. Deprecated: Flocker is deprecated and the in-tree flocker type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "downwardAPI": { + SchemaProps: spec.SchemaProps{ + Description: "downwardAPI represents downward API about the pod that should populate this volume", + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod. Deprecated: AzureFile is deprecated. All operations for the in-tree azureFile type are redirected to the file.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureFileVolumeSource"), + }, + }, + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "configMap represents a configMap that should populate this volume", + Ref: ref("k8s.io/api/core/v1.ConfigMapVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine. Deprecated: VsphereVolume is deprecated. All operations for the in-tree vsphereVolume type are redirected to the csi.vsphere.vmware.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime. Deprecated: Quobyte is deprecated and the in-tree quobyte type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod. Deprecated: AzureDisk is deprecated. All operations for the in-tree azureDisk type are redirected to the disk.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine. Deprecated: PhotonPersistentDisk is deprecated and the in-tree photonPersistentDisk type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "projected": { + SchemaProps: spec.SchemaProps{ + Description: "projected items for all in one resources secrets, configmaps, and downward API", + Ref: ref("k8s.io/api/core/v1.ProjectedVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine. Deprecated: PortworxVolume is deprecated. All operations for the in-tree portworxVolume type are redirected to the pxd.portworx.com CSI driver when the CSIMigrationPortworx feature-gate is on.", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes. Deprecated: ScaleIO is deprecated and the in-tree scaleIO type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.ScaleIOVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume attached and mounted on Kubernetes nodes. Deprecated: StorageOS is deprecated and the in-tree storageos type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.StorageOSVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi (Container Storage Interface) represents ephemeral storage that is handled by certain external CSI drivers.", + Ref: ref("k8s.io/api/core/v1.CSIVolumeSource"), + }, + }, + "ephemeral": { + SchemaProps: spec.SchemaProps{ + Description: "ephemeral represents a volume that is handled by a cluster storage driver. The volume's lifecycle is tied to the pod that defines it - it will be created before the pod starts, and deleted when the pod is removed.\n\nUse this if: a) the volume is only needed while the pod runs, b) features of normal volumes like restoring from snapshot or capacity\n tracking are needed,\nc) the storage driver is specified through a storage class, and d) the storage driver supports dynamic volume provisioning through\n a PersistentVolumeClaim (see EphemeralVolumeSource for more\n information on the connection between this volume type\n and PersistentVolumeClaim).\n\nUse PersistentVolumeClaim or one of the vendor-specific APIs for volumes that persist for longer than the lifecycle of an individual pod.\n\nUse CSI for light-weight local ephemeral volumes if the CSI driver is meant to be used that way - see the documentation of the driver for more information.\n\nA pod can use both types of ephemeral volumes and persistent volumes at the same time.", + Ref: ref("k8s.io/api/core/v1.EphemeralVolumeSource"), + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "image represents an OCI object (a container image or artifact) pulled and mounted on the kubelet's host machine. The volume is resolved at pod startup depending on which PullPolicy value is provided:\n\n- Always: the kubelet always attempts to pull the reference. Container creation will fail If the pull fails. - Never: the kubelet never pulls the reference and only uses a local image or artifact. Container creation will fail if the reference isn't present. - IfNotPresent: the kubelet pulls if the reference isn't already present on disk. Container creation will fail if the reference isn't present and the pull fails.\n\nThe volume gets re-resolved if the pod gets deleted and recreated, which means that new remote content will become available on pod recreation. A failure to resolve or pull the image during pod startup will block containers from starting and may add significant latency. Failures will be retried using normal volume backoff and will be reported on the pod reason and message. The types of objects that may be mounted by this volume are defined by the container runtime implementation on a host machine and at minimum must include all valid types supported by the container image field. The OCI object gets mounted in a single directory (spec.containers[*].volumeMounts.mountPath) by merging the manifest layers in the same way as for container images. The volume will be mounted read-only (ro) and non-executable files (noexec). Sub path mounts for containers are not supported (spec.containers[*].volumeMounts.subpath) before 1.33. The field spec.securityContext.fsGroupChangePolicy has no effect on this volume type.", + Ref: ref("k8s.io/api/core/v1.ImageVolumeSource"), + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFileVolumeSource", "k8s.io/api/core/v1.CSIVolumeSource", "k8s.io/api/core/v1.CephFSVolumeSource", "k8s.io/api/core/v1.CinderVolumeSource", "k8s.io/api/core/v1.ConfigMapVolumeSource", "k8s.io/api/core/v1.DownwardAPIVolumeSource", "k8s.io/api/core/v1.EmptyDirVolumeSource", "k8s.io/api/core/v1.EphemeralVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GitRepoVolumeSource", "k8s.io/api/core/v1.GlusterfsVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIVolumeSource", "k8s.io/api/core/v1.ImageVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.ProjectedVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDVolumeSource", "k8s.io/api/core/v1.ScaleIOVolumeSource", "k8s.io/api/core/v1.SecretVolumeSource", "k8s.io/api/core/v1.StorageOSVolumeSource", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"}, + } +} + +func schema_k8sio_api_core_v1_VolumeDevice(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "volumeDevice describes a mapping of a raw block device within a container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name must match the name of a persistentVolumeClaim in the pod", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "devicePath": { + SchemaProps: spec.SchemaProps{ + Description: "devicePath is the path inside of the container that the device will be mapped to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "devicePath"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_VolumeMount(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "VolumeMount describes a mounting of a Volume within a container.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "This must match the Name of a Volume.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "Mounted read-only if true, read-write otherwise (false or unspecified). Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "recursiveReadOnly": { + SchemaProps: spec.SchemaProps{ + Description: "RecursiveReadOnly specifies whether read-only mounts should be handled recursively.\n\nIf ReadOnly is false, this field has no meaning and must be unspecified.\n\nIf ReadOnly is true, and this field is set to Disabled, the mount is not made recursively read-only. If this field is set to IfPossible, the mount is made recursively read-only, if it is supported by the container runtime. If this field is set to Enabled, the mount is made recursively read-only if it is supported by the container runtime, otherwise the pod will not be started and an error will be generated to indicate the reason.\n\nIf this field is set to IfPossible or Enabled, MountPropagation must be set to None (or be unspecified, which defaults to None).\n\nIf this field is not specified, it is treated as an equivalent of Disabled.", + Type: []string{"string"}, + Format: "", + }, + }, + "mountPath": { + SchemaProps: spec.SchemaProps{ + Description: "Path within the container at which the volume should be mounted. Must not contain ':'.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "subPath": { + SchemaProps: spec.SchemaProps{ + Description: "Path within the volume from which the container's volume should be mounted. Defaults to \"\" (volume's root).", + Type: []string{"string"}, + Format: "", + }, + }, + "mountPropagation": { + SchemaProps: spec.SchemaProps{ + Description: "mountPropagation determines how mounts are propagated from the host to container and the other way around. When not set, MountPropagationNone is used. This field is beta in 1.10. When RecursiveReadOnly is set to IfPossible or to Enabled, MountPropagation must be None or unspecified (which defaults to None).\n\nPossible enum values:\n - `\"Bidirectional\"` means that the volume in a container will receive new mounts from the host or other containers, and its own mounts will be propagated from the container to the host or other containers. Note that this mode is recursively applied to all mounts in the volume (\"rshared\" in Linux terminology).\n - `\"HostToContainer\"` means that the volume in a container will receive new mounts from the host or other containers, but filesystems mounted inside the container won't be propagated to the host or other containers. Note that this mode is recursively applied to all mounts in the volume (\"rslave\" in Linux terminology).\n - `\"None\"` means that the volume in a container will not receive new mounts from the host or other containers, and filesystems mounted inside the container won't be propagated to the host or other containers. Note that this mode corresponds to \"private\" in Linux terminology.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Bidirectional", "HostToContainer", "None"}, + }, + }, + "subPathExpr": { + SchemaProps: spec.SchemaProps{ + Description: "Expanded path within the volume from which the container's volume should be mounted. Behaves similarly to SubPath but environment variable references $(VAR_NAME) are expanded using the container's environment. Defaults to \"\" (volume's root). SubPathExpr and SubPath are mutually exclusive.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "mountPath"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_VolumeMountStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "VolumeMountStatus shows status of volume mounts.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name corresponds to the name of the original VolumeMount.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "mountPath": { + SchemaProps: spec.SchemaProps{ + Description: "MountPath corresponds to the original VolumeMount.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "readOnly": { + SchemaProps: spec.SchemaProps{ + Description: "ReadOnly corresponds to the original VolumeMount.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "recursiveReadOnly": { + SchemaProps: spec.SchemaProps{ + Description: "RecursiveReadOnly must be set to Disabled, Enabled, or unspecified (for non-readonly mounts). An IfPossible value in the original VolumeMount must be translated to Disabled or Enabled, depending on the mount result.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "mountPath"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_VolumeNodeAffinity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "VolumeNodeAffinity defines constraints that limit what nodes this volume can be accessed from.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "required": { + SchemaProps: spec.SchemaProps{ + Description: "required specifies hard node constraints that must be met.", + Ref: ref("k8s.io/api/core/v1.NodeSelector"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.NodeSelector"}, + } +} + +func schema_k8sio_api_core_v1_VolumeProjection(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Projection that may be projected along with other supported volume types. Exactly one of these fields must be set.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "secret": { + SchemaProps: spec.SchemaProps{ + Description: "secret information about the secret data to project", + Ref: ref("k8s.io/api/core/v1.SecretProjection"), + }, + }, + "downwardAPI": { + SchemaProps: spec.SchemaProps{ + Description: "downwardAPI information about the downwardAPI data to project", + Ref: ref("k8s.io/api/core/v1.DownwardAPIProjection"), + }, + }, + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "configMap information about the configMap data to project", + Ref: ref("k8s.io/api/core/v1.ConfigMapProjection"), + }, + }, + "serviceAccountToken": { + SchemaProps: spec.SchemaProps{ + Description: "serviceAccountToken is information about the serviceAccountToken data to project", + Ref: ref("k8s.io/api/core/v1.ServiceAccountTokenProjection"), + }, + }, + "clusterTrustBundle": { + SchemaProps: spec.SchemaProps{ + Description: "ClusterTrustBundle allows a pod to access the `.spec.trustBundle` field of ClusterTrustBundle objects in an auto-updating file.\n\nAlpha, gated by the ClusterTrustBundleProjection feature gate.\n\nClusterTrustBundle objects can either be selected by name, or by the combination of signer name and a label selector.\n\nKubelet performs aggressive normalization of the PEM contents written into the pod filesystem. Esoteric PEM features such as inter-block comments and block headers are stripped. Certificates are deduplicated. The ordering of certificates within the file is arbitrary, and Kubelet may change the order over time.", + Ref: ref("k8s.io/api/core/v1.ClusterTrustBundleProjection"), + }, + }, + "podCertificate": { + SchemaProps: spec.SchemaProps{ + Description: "Projects an auto-rotating credential bundle (private key and certificate chain) that the pod can use either as a TLS client or server.\n\nKubelet generates a private key and uses it to send a PodCertificateRequest to the named signer. Once the signer approves the request and issues a certificate chain, Kubelet writes the key and certificate chain to the pod filesystem. The pod does not start until certificates have been issued for each podCertificate projected volume source in its spec.\n\nKubelet will begin trying to rotate the certificate at the time indicated by the signer using the PodCertificateRequest.Status.BeginRefreshAt timestamp.\n\nKubelet can write a single file, indicated by the credentialBundlePath field, or separate files, indicated by the keyPath and certificateChainPath fields.\n\nThe credential bundle is a single file in PEM format. The first PEM entry is the private key (in PKCS#8 format), and the remaining PEM entries are the certificate chain issued by the signer (typically, signers will return their certificate chain in leaf-to-root order).\n\nPrefer using the credential bundle format, since your application code can read it atomically. If you use keyPath and certificateChainPath, your application must make two separate file reads. If these coincide with a certificate rotation, it is possible that the private key and leaf certificate you read may not correspond to each other. Your application will need to check for this condition, and re-read until they are consistent.\n\nThe named signer controls chooses the format of the certificate it issues; consult the signer implementation's documentation to learn how to use the certificates it issues.", + Ref: ref("k8s.io/api/core/v1.PodCertificateProjection"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.ClusterTrustBundleProjection", "k8s.io/api/core/v1.ConfigMapProjection", "k8s.io/api/core/v1.DownwardAPIProjection", "k8s.io/api/core/v1.PodCertificateProjection", "k8s.io/api/core/v1.SecretProjection", "k8s.io/api/core/v1.ServiceAccountTokenProjection"}, + } +} + +func schema_k8sio_api_core_v1_VolumeResourceRequirements(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "VolumeResourceRequirements describes the storage resource requirements for a volume.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "limits": { + SchemaProps: spec.SchemaProps{ + Description: "Limits describes the maximum amount of compute resources allowed. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + "requests": { + SchemaProps: spec.SchemaProps{ + Description: "Requests describes the minimum amount of compute resources required. If Requests is omitted for a container, it defaults to Limits if that is explicitly specified, otherwise to an implementation-defined value. Requests cannot exceed Limits. More info: https://kubernetes.io/docs/concepts/configuration/manage-resources-containers/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/api/resource.Quantity"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/api/resource.Quantity"}, + } +} + +func schema_k8sio_api_core_v1_VolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents the source of a volume to mount. Only one of its members may be specified.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a pre-existing file or directory on the host machine that is directly exposed to the container. This is generally used for system agents or other privileged things that are allowed to see the host machine. Most containers will NOT need this. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "emptyDir": { + SchemaProps: spec.SchemaProps{ + Description: "emptyDir represents a temporary directory that shares a pod's lifetime. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Ref: ref("k8s.io/api/core/v1.EmptyDirVolumeSource"), + }, + }, + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: GCEPersistentDisk is deprecated. All operations for the in-tree gcePersistentDisk type are redirected to the pd.csi.storage.gke.io CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. Deprecated: AWSElasticBlockStore is deprecated. All operations for the in-tree awsElasticBlockStore type are redirected to the ebs.csi.aws.com CSI driver. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "gitRepo": { + SchemaProps: spec.SchemaProps{ + Description: "gitRepo represents a git repository at a particular revision. Deprecated: GitRepo is deprecated. To provision a container with a git repo, mount an EmptyDir into an InitContainer that clones the repo using git, then mount the EmptyDir into the Pod's container.", + Ref: ref("k8s.io/api/core/v1.GitRepoVolumeSource"), + }, + }, + "secret": { + SchemaProps: spec.SchemaProps{ + Description: "secret represents a secret that should populate this volume. More info: https://kubernetes.io/docs/concepts/storage/volumes#secret", + Ref: ref("k8s.io/api/core/v1.SecretVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host that shares a pod's lifetime More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes/#iscsi", + Ref: ref("k8s.io/api/core/v1.ISCSIVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs mount on the host that shares a pod's lifetime. Deprecated: Glusterfs is deprecated and the in-tree glusterfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.GlusterfsVolumeSource"), + }, + }, + "persistentVolumeClaim": { + SchemaProps: spec.SchemaProps{ + Description: "persistentVolumeClaimVolumeSource represents a reference to a PersistentVolumeClaim in the same namespace. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. Deprecated: RBD is deprecated and the in-tree rbd type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.RBDVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin. Deprecated: FlexVolume is deprecated. Consider using a CSIDriver instead.", + Ref: ref("k8s.io/api/core/v1.FlexVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. Deprecated: Cinder is deprecated. All operations for the in-tree cinder type are redirected to the cinder.csi.openstack.org CSI driver. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime. Deprecated: CephFS is deprecated and the in-tree cephfs type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.CephFSVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine. This depends on the Flocker control service being running. Deprecated: Flocker is deprecated and the in-tree flocker type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "downwardAPI": { + SchemaProps: spec.SchemaProps{ + Description: "downwardAPI represents downward API about the pod that should populate this volume", + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod. Deprecated: AzureFile is deprecated. All operations for the in-tree azureFile type are redirected to the file.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureFileVolumeSource"), + }, + }, + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "configMap represents a configMap that should populate this volume", + Ref: ref("k8s.io/api/core/v1.ConfigMapVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine. Deprecated: VsphereVolume is deprecated. All operations for the in-tree vsphereVolume type are redirected to the csi.vsphere.vmware.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime. Deprecated: Quobyte is deprecated and the in-tree quobyte type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod. Deprecated: AzureDisk is deprecated. All operations for the in-tree azureDisk type are redirected to the disk.csi.azure.com CSI driver.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine. Deprecated: PhotonPersistentDisk is deprecated and the in-tree photonPersistentDisk type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "projected": { + SchemaProps: spec.SchemaProps{ + Description: "projected items for all in one resources secrets, configmaps, and downward API", + Ref: ref("k8s.io/api/core/v1.ProjectedVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine. Deprecated: PortworxVolume is deprecated. All operations for the in-tree portworxVolume type are redirected to the pxd.portworx.com CSI driver when the CSIMigrationPortworx feature-gate is on.", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes. Deprecated: ScaleIO is deprecated and the in-tree scaleIO type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.ScaleIOVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume attached and mounted on Kubernetes nodes. Deprecated: StorageOS is deprecated and the in-tree storageos type is no longer supported.", + Ref: ref("k8s.io/api/core/v1.StorageOSVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi (Container Storage Interface) represents ephemeral storage that is handled by certain external CSI drivers.", + Ref: ref("k8s.io/api/core/v1.CSIVolumeSource"), + }, + }, + "ephemeral": { + SchemaProps: spec.SchemaProps{ + Description: "ephemeral represents a volume that is handled by a cluster storage driver. The volume's lifecycle is tied to the pod that defines it - it will be created before the pod starts, and deleted when the pod is removed.\n\nUse this if: a) the volume is only needed while the pod runs, b) features of normal volumes like restoring from snapshot or capacity\n tracking are needed,\nc) the storage driver is specified through a storage class, and d) the storage driver supports dynamic volume provisioning through\n a PersistentVolumeClaim (see EphemeralVolumeSource for more\n information on the connection between this volume type\n and PersistentVolumeClaim).\n\nUse PersistentVolumeClaim or one of the vendor-specific APIs for volumes that persist for longer than the lifecycle of an individual pod.\n\nUse CSI for light-weight local ephemeral volumes if the CSI driver is meant to be used that way - see the documentation of the driver for more information.\n\nA pod can use both types of ephemeral volumes and persistent volumes at the same time.", + Ref: ref("k8s.io/api/core/v1.EphemeralVolumeSource"), + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Description: "image represents an OCI object (a container image or artifact) pulled and mounted on the kubelet's host machine. The volume is resolved at pod startup depending on which PullPolicy value is provided:\n\n- Always: the kubelet always attempts to pull the reference. Container creation will fail If the pull fails. - Never: the kubelet never pulls the reference and only uses a local image or artifact. Container creation will fail if the reference isn't present. - IfNotPresent: the kubelet pulls if the reference isn't already present on disk. Container creation will fail if the reference isn't present and the pull fails.\n\nThe volume gets re-resolved if the pod gets deleted and recreated, which means that new remote content will become available on pod recreation. A failure to resolve or pull the image during pod startup will block containers from starting and may add significant latency. Failures will be retried using normal volume backoff and will be reported on the pod reason and message. The types of objects that may be mounted by this volume are defined by the container runtime implementation on a host machine and at minimum must include all valid types supported by the container image field. The OCI object gets mounted in a single directory (spec.containers[*].volumeMounts.mountPath) by merging the manifest layers in the same way as for container images. The volume will be mounted read-only (ro) and non-executable files (noexec). Sub path mounts for containers are not supported (spec.containers[*].volumeMounts.subpath) before 1.33. The field spec.securityContext.fsGroupChangePolicy has no effect on this volume type.", + Ref: ref("k8s.io/api/core/v1.ImageVolumeSource"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFileVolumeSource", "k8s.io/api/core/v1.CSIVolumeSource", "k8s.io/api/core/v1.CephFSVolumeSource", "k8s.io/api/core/v1.CinderVolumeSource", "k8s.io/api/core/v1.ConfigMapVolumeSource", "k8s.io/api/core/v1.DownwardAPIVolumeSource", "k8s.io/api/core/v1.EmptyDirVolumeSource", "k8s.io/api/core/v1.EphemeralVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GitRepoVolumeSource", "k8s.io/api/core/v1.GlusterfsVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIVolumeSource", "k8s.io/api/core/v1.ImageVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.ProjectedVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDVolumeSource", "k8s.io/api/core/v1.ScaleIOVolumeSource", "k8s.io/api/core/v1.SecretVolumeSource", "k8s.io/api/core/v1.StorageOSVolumeSource", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"}, + } +} + +func schema_k8sio_api_core_v1_VsphereVirtualDiskVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents a vSphere volume resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumePath": { + SchemaProps: spec.SchemaProps{ + Description: "volumePath is the path that identifies vSphere volume vmdk", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "fsType": { + SchemaProps: spec.SchemaProps{ + Description: "fsType is filesystem type to mount. Must be a filesystem type supported by the host operating system. Ex. \"ext4\", \"xfs\", \"ntfs\". Implicitly inferred to be \"ext4\" if unspecified.", + Type: []string{"string"}, + Format: "", + }, + }, + "storagePolicyName": { + SchemaProps: spec.SchemaProps{ + Description: "storagePolicyName is the storage Policy Based Management (SPBM) profile name.", + Type: []string{"string"}, + Format: "", + }, + }, + "storagePolicyID": { + SchemaProps: spec.SchemaProps{ + Description: "storagePolicyID is the storage Policy Based Management (SPBM) profile ID associated with the StoragePolicyName.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"volumePath"}, + }, + }, + } +} + +func schema_k8sio_api_core_v1_WeightedPodAffinityTerm(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "The weights of all of the matched WeightedPodAffinityTerm fields are added per-node to find the most preferred node(s)", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "weight": { + SchemaProps: spec.SchemaProps{ + Description: "weight associated with matching the corresponding podAffinityTerm, in the range 1-100.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "podAffinityTerm": { + SchemaProps: spec.SchemaProps{ + Description: "Required. A pod affinity term, associated with the corresponding weight.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodAffinityTerm"), + }, + }, + }, + Required: []string{"weight", "podAffinityTerm"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PodAffinityTerm"}, + } +} + +func schema_k8sio_api_core_v1_WindowsSecurityContextOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "WindowsSecurityContextOptions contain Windows-specific options and credentials.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "gmsaCredentialSpecName": { + SchemaProps: spec.SchemaProps{ + Description: "GMSACredentialSpecName is the name of the GMSA credential spec to use.", + Type: []string{"string"}, + Format: "", + }, + }, + "gmsaCredentialSpec": { + SchemaProps: spec.SchemaProps{ + Description: "GMSACredentialSpec is where the GMSA admission webhook (https://github.com/kubernetes-sigs/windows-gmsa) inlines the contents of the GMSA credential spec named by the GMSACredentialSpecName field.", + Type: []string{"string"}, + Format: "", + }, + }, + "runAsUserName": { + SchemaProps: spec.SchemaProps{ + Description: "The UserName in Windows to run the entrypoint of the container process. Defaults to the user specified in image metadata if unspecified. May also be set in PodSecurityContext. If set in both SecurityContext and PodSecurityContext, the value specified in SecurityContext takes precedence.", + Type: []string{"string"}, + Format: "", + }, + }, + "hostProcess": { + SchemaProps: spec.SchemaProps{ + Description: "HostProcess determines if a container should be run as a 'Host Process' container. All of a Pod's containers must have the same effective HostProcess value (it is not allowed to have a mix of HostProcess containers and non-HostProcess containers). In addition, if HostProcess is true then HostNetwork must also be set to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_apimachinery_pkg_api_resource_Quantity(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.EmbedOpenAPIDefinitionIntoV2Extension(common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Quantity is a fixed-point representation of a number. It provides convenient marshaling/unmarshaling in JSON and YAML, in addition to String() and AsInt64() accessors.\n\nThe serialization format is:\n\n``` ::= \n\n\t(Note that may be empty, from the \"\" case in .)\n\n ::= 0 | 1 | ... | 9 ::= | ::= | . | . | . ::= \"+\" | \"-\" ::= | ::= | | ::= Ki | Mi | Gi | Ti | Pi | Ei\n\n\t(International System of units; See: http://physics.nist.gov/cuu/Units/binary.html)\n\n ::= m | \"\" | k | M | G | T | P | E\n\n\t(Note that 1024 = 1Ki but 1000 = 1k; I didn't choose the capitalization.)\n\n ::= \"e\" | \"E\" ```\n\nNo matter which of the three exponent forms is used, no quantity may represent a number greater than 2^63-1 in magnitude, nor may it have more than 3 decimal places. Numbers larger or more precise will be capped or rounded up. (E.g.: 0.1m will rounded up to 1m.) This may be extended in the future if we require larger or smaller quantities.\n\nWhen a Quantity is parsed from a string, it will remember the type of suffix it had, and will use the same type again when it is serialized.\n\nBefore serializing, Quantity will be put in \"canonical form\". This means that Exponent/suffix will be adjusted up or down (with a corresponding increase or decrease in Mantissa) such that:\n\n- No precision is lost - No fractional digits will be emitted - The exponent (or suffix) is as large as possible.\n\nThe sign will be omitted unless the number is negative.\n\nExamples:\n\n- 1.5 will be serialized as \"1500m\" - 1.5Gi will be serialized as \"1536Mi\"\n\nNote that the quantity will NEVER be internally represented by a floating point number. That is the whole point of this exercise.\n\nNon-canonical values will still parse as long as they are well formed, but will be re-emitted in their canonical form. (So always use canonical form, or don't diff.)\n\nThis format is intended to make it difficult to use these numbers without writing some sort of special handling code in the hopes that that will cause implementors to also use a fixed point implementation.", + OneOf: common.GenerateOpenAPIV3OneOfSchema(resource.Quantity{}.OpenAPIV3OneOfTypes()), + Format: resource.Quantity{}.OpenAPISchemaFormat(), + }, + }, + }, common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Quantity is a fixed-point representation of a number. It provides convenient marshaling/unmarshaling in JSON and YAML, in addition to String() and AsInt64() accessors.\n\nThe serialization format is:\n\n``` ::= \n\n\t(Note that may be empty, from the \"\" case in .)\n\n ::= 0 | 1 | ... | 9 ::= | ::= | . | . | . ::= \"+\" | \"-\" ::= | ::= | | ::= Ki | Mi | Gi | Ti | Pi | Ei\n\n\t(International System of units; See: http://physics.nist.gov/cuu/Units/binary.html)\n\n ::= m | \"\" | k | M | G | T | P | E\n\n\t(Note that 1024 = 1Ki but 1000 = 1k; I didn't choose the capitalization.)\n\n ::= \"e\" | \"E\" ```\n\nNo matter which of the three exponent forms is used, no quantity may represent a number greater than 2^63-1 in magnitude, nor may it have more than 3 decimal places. Numbers larger or more precise will be capped or rounded up. (E.g.: 0.1m will rounded up to 1m.) This may be extended in the future if we require larger or smaller quantities.\n\nWhen a Quantity is parsed from a string, it will remember the type of suffix it had, and will use the same type again when it is serialized.\n\nBefore serializing, Quantity will be put in \"canonical form\". This means that Exponent/suffix will be adjusted up or down (with a corresponding increase or decrease in Mantissa) such that:\n\n- No precision is lost - No fractional digits will be emitted - The exponent (or suffix) is as large as possible.\n\nThe sign will be omitted unless the number is negative.\n\nExamples:\n\n- 1.5 will be serialized as \"1500m\" - 1.5Gi will be serialized as \"1536Mi\"\n\nNote that the quantity will NEVER be internally represented by a floating point number. That is the whole point of this exercise.\n\nNon-canonical values will still parse as long as they are well formed, but will be re-emitted in their canonical form. (So always use canonical form, or don't diff.)\n\nThis format is intended to make it difficult to use these numbers without writing some sort of special handling code in the hopes that that will cause implementors to also use a fixed point implementation.", + Type: resource.Quantity{}.OpenAPISchemaType(), + Format: resource.Quantity{}.OpenAPISchemaFormat(), + }, + }, + }) +} + +func schema_apimachinery_pkg_api_resource_int64Amount(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "int64Amount represents a fixed precision numerator and arbitrary scale exponent. It is faster than operations on inf.Dec for values that can be represented as int64.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "value": { + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + "scale": { + SchemaProps: spec.SchemaProps{ + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"value", "scale"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_APIGroup(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "APIGroup contains the name, the supported versions, and the preferred version of a group.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name is the name of the group.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "versions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "versions are the versions supported in this group.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionForDiscovery"), + }, + }, + }, + }, + }, + "preferredVersion": { + SchemaProps: spec.SchemaProps{ + Description: "preferredVersion is the version preferred by the API server, which probably is the storage version.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionForDiscovery"), + }, + }, + "serverAddressByClientCIDRs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "a map of client CIDR to server address that is serving this group. This is to help clients reach servers in the most network-efficient way possible. Clients can use the appropriate server address as per the CIDR that they match. In case of multiple matches, clients should use the longest matching CIDR. The server returns only those CIDRs that it thinks that the client can match. For example: the master will return an internal IP CIDR only, if the client reaches the server using an internal IP. Server looks at X-Forwarded-For header or X-Real-Ip header or request.RemoteAddr (in that order) to get the client IP.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ServerAddressByClientCIDR"), + }, + }, + }, + }, + }, + }, + Required: []string{"name", "versions"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupVersionForDiscovery", "k8s.io/apimachinery/pkg/apis/meta/v1.ServerAddressByClientCIDR"}, + } +} + +func schema_pkg_apis_meta_v1_APIGroupList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "APIGroupList is a list of APIGroup, to allow clients to discover the API at /apis.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "groups": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "groups is a list of APIGroup.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.APIGroup"), + }, + }, + }, + }, + }, + }, + Required: []string{"groups"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.APIGroup"}, + } +} + +func schema_pkg_apis_meta_v1_APIResource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "APIResource specifies the name of a resource and whether it is namespaced.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name is the plural name of the resource.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "singularName": { + SchemaProps: spec.SchemaProps{ + Description: "singularName is the singular name of the resource. This allows clients to handle plural and singular opaquely. The singularName is more correct for reporting status on a single item and both singular and plural are allowed from the kubectl CLI interface.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespaced": { + SchemaProps: spec.SchemaProps{ + Description: "namespaced indicates if a resource is namespaced or not.", + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "group": { + SchemaProps: spec.SchemaProps{ + Description: "group is the preferred group of the resource. Empty implies the group of the containing resource list. For subresources, this may have a different value, for example: Scale\".", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Description: "version is the preferred version of the resource. Empty implies the version of the containing resource list For subresources, this may have a different value, for example: v1 (while inside a v1beta1 version of the core resource's group)\".", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "kind is the kind for the resource (e.g. 'Foo' is the kind for a resource 'foo')", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "verbs": { + SchemaProps: spec.SchemaProps{ + Description: "verbs is a list of supported kube verbs (this includes get, list, watch, create, update, patch, delete, deletecollection, and proxy)", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "shortNames": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "shortNames is a list of suggested short names of the resource.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "categories": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "categories is a list of the grouped resources this resource belongs to (e.g. 'all')", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "storageVersionHash": { + SchemaProps: spec.SchemaProps{ + Description: "The hash value of the storage version, the version this resource is converted to when written to the data store. Value must be treated as opaque by clients. Only equality comparison on the value is valid. This is an alpha feature and may change or be removed in the future. The field is populated by the apiserver only if the StorageVersionHash feature gate is enabled. This field will remain optional even if it graduates.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "singularName", "namespaced", "kind", "verbs"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_APIResourceList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "APIResourceList is a list of APIResource, it is used to expose the name of the resources supported in a specific group and version, and if the resource is namespaced.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "groupVersion": { + SchemaProps: spec.SchemaProps{ + Description: "groupVersion is the group and version this APIResourceList is for.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resources": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "resources contains the name of the resources and if they are namespaced.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.APIResource"), + }, + }, + }, + }, + }, + }, + Required: []string{"groupVersion", "resources"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.APIResource"}, + } +} + +func schema_pkg_apis_meta_v1_APIVersions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "APIVersions lists the versions that are available, to allow clients to discover the API at /api, which is the root path of the legacy v1 API.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "versions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "versions are the api versions that are available.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "serverAddressByClientCIDRs": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "a map of client CIDR to server address that is serving this group. This is to help clients reach servers in the most network-efficient way possible. Clients can use the appropriate server address as per the CIDR that they match. In case of multiple matches, clients should use the longest matching CIDR. The server returns only those CIDRs that it thinks that the client can match. For example: the master will return an internal IP CIDR only, if the client reaches the server using an internal IP. Server looks at X-Forwarded-For header or X-Real-Ip header or request.RemoteAddr (in that order) to get the client IP.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ServerAddressByClientCIDR"), + }, + }, + }, + }, + }, + }, + Required: []string{"versions", "serverAddressByClientCIDRs"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ServerAddressByClientCIDR"}, + } +} + +func schema_pkg_apis_meta_v1_ApplyOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ApplyOptions may be provided when applying an API object. FieldManager is required for apply requests. ApplyOptions is equivalent to PatchOptions. It is provided as a convenience with documentation that speaks specifically to how the options fields relate to apply.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "dryRun": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "force": { + SchemaProps: spec.SchemaProps{ + Description: "Force is going to \"force\" Apply requests. It means user will re-acquire conflicting fields owned by other people.", + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "fieldManager": { + SchemaProps: spec.SchemaProps{ + Description: "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint. This field is required.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"force", "fieldManager"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_Condition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Condition contains details for one aspect of the current state of this API Resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type of condition in CamelCase or in foo.example.com/CamelCase.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "observedGeneration": { + SchemaProps: spec.SchemaProps{ + Description: "observedGeneration represents the .metadata.generation that the condition was set based upon. For instance, if .metadata.generation is currently 12, but the .status.conditions[x].observedGeneration is 9, the condition is out of date with respect to the current state of the instance.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "lastTransitionTime is the last time the condition transitioned from one status to another. This should be when the underlying condition changed. If that is not known, then using the time when the API field changed is acceptable.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "reason contains a programmatic identifier indicating the reason for the condition's last transition. Producers of specific condition types may define expected values and meanings for this field, and whether the values are considered a guaranteed API. The value should be a CamelCase string. This field may not be empty.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "message is a human readable message indicating details about the transition. This may be an empty string.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status", "lastTransitionTime", "reason", "message"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_pkg_apis_meta_v1_CreateOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "CreateOptions may be provided when creating an API object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "dryRun": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "fieldManager": { + SchemaProps: spec.SchemaProps{ + Description: "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint.", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldValidation": { + SchemaProps: spec.SchemaProps{ + Description: "fieldValidation instructs the server on how to handle objects in the request (POST/PUT/PATCH) containing unknown or duplicate fields. Valid values are: - Ignore: This will ignore any unknown fields that are silently dropped from the object, and will ignore all but the last duplicate field that the decoder encounters. This is the default behavior prior to v1.23. - Warn: This will send a warning via the standard warning response header for each unknown field that is dropped from the object, and for each duplicate field that is encountered. The request will still succeed if there are no other errors, and will only persist the last of any duplicate fields. This is the default in v1.23+ - Strict: This will fail the request with a BadRequest error if any unknown fields would be dropped from the object, or if any duplicate fields are present. The error returned from the server will contain all unknown and duplicate fields encountered.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_DeleteOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "DeleteOptions may be provided when deleting an API object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "gracePeriodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "The duration in seconds before the object should be deleted. Value must be non-negative integer. The value zero indicates delete immediately. If this value is nil, the default grace period for the specified type will be used. Defaults to a per object value if not specified. zero means delete immediately.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "preconditions": { + SchemaProps: spec.SchemaProps{ + Description: "Must be fulfilled before a deletion is carried out. If not possible, a 409 Conflict status will be returned.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Preconditions"), + }, + }, + "orphanDependents": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated: please use the PropagationPolicy, this field will be deprecated in 1.7. Should the dependent objects be orphaned. If true/false, the \"orphan\" finalizer will be added to/removed from the object's finalizers list. Either this field or PropagationPolicy may be set, but not both.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "propagationPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Whether and how garbage collection will be performed. Either this field or OrphanDependents may be set, but not both. The default policy is decided by the existing finalizer set in the metadata.finalizers and the resource-specific default policy. Acceptable values are: 'Orphan' - orphan the dependents; 'Background' - allow the garbage collector to delete the dependents in the background; 'Foreground' - a cascading policy that deletes all dependents in the foreground.", + Type: []string{"string"}, + Format: "", + }, + }, + "dryRun": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "ignoreStoreReadErrorWithClusterBreakingPotential": { + SchemaProps: spec.SchemaProps{ + Description: "if set to true, it will trigger an unsafe deletion of the resource in case the normal deletion flow fails with a corrupt object error. A resource is considered corrupt if it can not be retrieved from the underlying storage successfully because of a) its data can not be transformed e.g. decryption failure, or b) it fails to decode into an object. NOTE: unsafe deletion ignores finalizer constraints, skips precondition checks, and removes the object from the storage. WARNING: This may potentially break the cluster if the workload associated with the resource being unsafe-deleted relies on normal deletion flow. Use only if you REALLY know what you are doing. The default value is false, and the user must opt in to enable it", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Preconditions"}, + } +} + +func schema_pkg_apis_meta_v1_Duration(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Duration is a wrapper around time.Duration which supports correct marshaling to YAML and JSON. In particular, it marshals into strings, which can be used as map keys in json.", + Type: metav1.Duration{}.OpenAPISchemaType(), + Format: metav1.Duration{}.OpenAPISchemaFormat(), + }, + }, + } +} + +func schema_pkg_apis_meta_v1_FieldSelectorRequirement(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "FieldSelectorRequirement is a selector that contains values, a key, and an operator that relates the key and values.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "key is the field selector key that the requirement applies to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "operator represents a key's relationship to a set of values. Valid operators are In, NotIn, Exists, DoesNotExist. The list of operators may grow in the future.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "values is an array of string values. If the operator is In or NotIn, the values array must be non-empty. If the operator is Exists or DoesNotExist, the values array must be empty.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"key", "operator"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_FieldsV1(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "FieldsV1 stores a set of fields in a data structure like a Trie, in JSON format.\n\nEach key is either a '.' representing the field itself, and will always map to an empty set, or a string representing a sub-field or item. The string will follow one of these four formats: 'f:', where is the name of a field in a struct, or key in a map 'v:', where is the exact json formatted value of a list item 'i:', where is position of a item in a list 'k:', where is a map of a list item's key fields to their unique values If a key maps to an empty Fields value, the field that key represents is part of the set.\n\nThe exact format is defined in sigs.k8s.io/structured-merge-diff", + Type: []string{"object"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GetOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GetOptions is the standard query options to the standard REST get call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "resourceVersion sets a constraint on what resource versions a request may be served from. See https://kubernetes.io/docs/reference/using-api/api-concepts/#resource-versions for details.\n\nDefaults to unset", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupKind(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupKind specifies a Group and a Kind, but does not force a version. This is useful for identifying concepts during lookup stages without having partially valid types", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group", "kind"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupResource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupResource specifies a Group and a Resource, but does not force a version. This is useful for identifying concepts during lookup stages without having partially valid types", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resource": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group", "resource"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupVersion(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupVersion contains the \"group\" and the \"version\", which uniquely identifies the API.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group", "version"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupVersionForDiscovery(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupVersion contains the \"group/version\" and \"version\" string of a version. It is made a struct to keep extensibility.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "groupVersion": { + SchemaProps: spec.SchemaProps{ + Description: "groupVersion specifies the API group and version in the form \"group/version\"", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Description: "version specifies the version in the form of \"version\". This is to save the clients the trouble of splitting the GroupVersion.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"groupVersion", "version"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupVersionKind(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupVersionKind unambiguously identifies a kind. It doesn't anonymously include GroupVersion to avoid automatic coercion. It doesn't use a GroupVersion to avoid custom marshalling", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group", "version", "kind"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_GroupVersionResource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GroupVersionResource unambiguously identifies a resource. It doesn't anonymously include GroupVersion to avoid automatic coercion. It doesn't use a GroupVersion to avoid custom marshalling", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "resource": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group", "version", "resource"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_InternalEvent(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "InternalEvent makes watch.Event versioned", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "Type": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "Object": { + SchemaProps: spec.SchemaProps{ + Description: "Object is:\n * If Type is Added or Modified: the new state of the object.\n * If Type is Deleted: the state of the object immediately before deletion.\n * If Type is Bookmark: the object (instance of a type being watched) where\n only ResourceVersion field is set. On successful restart of watch from a\n bookmark resourceVersion, client is guaranteed to not get repeat event\n nor miss any events.\n * If Type is Error: *api.Status is recommended; other types may make sense\n depending on context.", + Ref: ref("k8s.io/apimachinery/pkg/runtime.Object"), + }, + }, + }, + Required: []string{"Type", "Object"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.Object"}, + } +} + +func schema_pkg_apis_meta_v1_LabelSelector(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A label selector is a label query over a set of resources. The result of matchLabels and matchExpressions are ANDed. An empty label selector matches all objects. A null label selector matches no objects.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "matchLabels": { + SchemaProps: spec.SchemaProps{ + Description: "matchLabels is a map of {key,value} pairs. A single {key,value} in the matchLabels map is equivalent to an element of matchExpressions, whose key field is \"key\", the operator is \"In\", and the values array contains only \"value\". The requirements are ANDed.", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "matchExpressions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "matchExpressions is a list of label selector requirements. The requirements are ANDed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelectorRequirement"), + }, + }, + }, + }, + }, + }, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.LabelSelectorRequirement"}, + } +} + +func schema_pkg_apis_meta_v1_LabelSelectorRequirement(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "A label selector requirement is a selector that contains values, a key, and an operator that relates the key and values.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "key": { + SchemaProps: spec.SchemaProps{ + Description: "key is the label key that the selector applies to.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "operator": { + SchemaProps: spec.SchemaProps{ + Description: "operator represents a key's relationship to a set of values. Valid operators are In, NotIn, Exists and DoesNotExist.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "values is an array of string values. If the operator is In or NotIn, the values array must be non-empty. If the operator is Exists or DoesNotExist, the values array must be empty. This array is replaced during a strategic merge patch.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"key", "operator"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_List(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "List holds a list of objects, which may not be known by the server.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "List of objects", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_pkg_apis_meta_v1_ListMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ListMeta describes metadata that synthetic resources must have, including lists and various status objects. A resource may have only one of {ObjectMeta, ListMeta}.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "selfLink": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated: selfLink is a legacy read-only field that is no longer populated by the system.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "String that identifies the server's internal version of this object that can be used by clients to determine when objects have changed. Value must be treated as opaque by clients and passed unmodified back to the server. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#concurrency-control-and-consistency", + Type: []string{"string"}, + Format: "", + }, + }, + "continue": { + SchemaProps: spec.SchemaProps{ + Description: "continue may be set if the user set a limit on the number of items returned, and indicates that the server has more data available. The value is opaque and may be used to issue another request to the endpoint that served this list to retrieve the next set of available objects. Continuing a consistent list may not be possible if the server configuration has changed or more than a few minutes have passed. The resourceVersion field returned when using this continue value will be identical to the value in the first response, unless you have received this token from an error message.", + Type: []string{"string"}, + Format: "", + }, + }, + "remainingItemCount": { + SchemaProps: spec.SchemaProps{ + Description: "remainingItemCount is the number of subsequent items in the list which are not included in this list response. If the list request contained label or field selectors, then the number of remaining items is unknown and the field will be left unset and omitted during serialization. If the list is complete (either because it is not chunking or because this is the last chunk), then there are no more remaining items and this field will be left unset and omitted during serialization. Servers older than v1.15 do not set this field. The intended use of the remainingItemCount is *estimating* the size of a collection. Clients should not rely on the remainingItemCount to be set or to be exact.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_ListOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ListOptions is the query options to a standard REST list call.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "labelSelector": { + SchemaProps: spec.SchemaProps{ + Description: "A selector to restrict the list of returned objects by their labels. Defaults to everything.", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldSelector": { + SchemaProps: spec.SchemaProps{ + Description: "A selector to restrict the list of returned objects by their fields. Defaults to everything.", + Type: []string{"string"}, + Format: "", + }, + }, + "watch": { + SchemaProps: spec.SchemaProps{ + Description: "Watch for changes to the described resources and return them as a stream of add, update, and remove notifications. Specify resourceVersion.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "allowWatchBookmarks": { + SchemaProps: spec.SchemaProps{ + Description: "allowWatchBookmarks requests watch events with type \"BOOKMARK\". Servers that do not implement bookmarks may ignore this flag and bookmarks are sent at the server's discretion. Clients should not assume bookmarks are returned at any specific interval, nor may they assume the server will send any BOOKMARK event during a session. If this is not a watch, this field is ignored.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "resourceVersion sets a constraint on what resource versions a request may be served from. See https://kubernetes.io/docs/reference/using-api/api-concepts/#resource-versions for details.\n\nDefaults to unset", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersionMatch": { + SchemaProps: spec.SchemaProps{ + Description: "resourceVersionMatch determines how resourceVersion is applied to list calls. It is highly recommended that resourceVersionMatch be set for list calls where resourceVersion is set See https://kubernetes.io/docs/reference/using-api/api-concepts/#resource-versions for details.\n\nDefaults to unset", + Type: []string{"string"}, + Format: "", + }, + }, + "timeoutSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Timeout for the list/watch call. This limits the duration of the call, regardless of any activity or inactivity.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "limit": { + SchemaProps: spec.SchemaProps{ + Description: "limit is a maximum number of responses to return for a list call. If more items exist, the server will set the `continue` field on the list metadata to a value that can be used with the same initial query to retrieve the next set of results. Setting a limit may return fewer than the requested amount of items (up to zero items) in the event all requested objects are filtered out and clients should only use the presence of the continue field to determine whether more results are available. Servers may choose not to support the limit argument and will return all of the available results. If limit is specified and the continue field is empty, clients may assume that no more results are available. This field is not supported if watch is true.\n\nThe server guarantees that the objects returned when using continue will be identical to issuing a single list call without a limit - that is, no objects created, modified, or deleted after the first request is issued will be included in any subsequent continued requests. This is sometimes referred to as a consistent snapshot, and ensures that a client that is using limit to receive smaller chunks of a very large result can ensure they see all possible objects. If objects are updated during a chunked list the version of the object that was present at the time the first list result was calculated is returned.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "continue": { + SchemaProps: spec.SchemaProps{ + Description: "The continue option should be set when retrieving more results from the server. Since this value is server defined, clients may only use the continue value from a previous query result with identical query parameters (except for the value of continue) and the server may reject a continue value it does not recognize. If the specified continue value is no longer valid whether due to expiration (generally five to fifteen minutes) or a configuration change on the server, the server will respond with a 410 ResourceExpired error together with a continue token. If the client needs a consistent list, it must restart their list without the continue field. Otherwise, the client may send another list request with the token received with the 410 error, the server will respond with a list starting from the next key, but from the latest snapshot, which is inconsistent from the previous list results - objects that are created, modified, or deleted after the first list request will be included in the response, as long as their keys are after the \"next key\".\n\nThis field is not supported when watch is true. Clients may start a watch from the last resourceVersion value returned by the server and not miss any modifications.", + Type: []string{"string"}, + Format: "", + }, + }, + "sendInitialEvents": { + SchemaProps: spec.SchemaProps{ + Description: "`sendInitialEvents=true` may be set together with `watch=true`. In that case, the watch stream will begin with synthetic events to produce the current state of objects in the collection. Once all such events have been sent, a synthetic \"Bookmark\" event will be sent. The bookmark will report the ResourceVersion (RV) corresponding to the set of objects, and be marked with `\"k8s.io/initial-events-end\": \"true\"` annotation. Afterwards, the watch stream will proceed as usual, sending watch events corresponding to changes (subsequent to the RV) to objects watched.\n\nWhen `sendInitialEvents` option is set, we require `resourceVersionMatch` option to also be set. The semantic of the watch request is as following: - `resourceVersionMatch` = NotOlderThan\n is interpreted as \"data at least as new as the provided `resourceVersion`\"\n and the bookmark event is send when the state is synced\n to a `resourceVersion` at least as fresh as the one provided by the ListOptions.\n If `resourceVersion` is unset, this is interpreted as \"consistent read\" and the\n bookmark event is send when the state is synced at least to the moment\n when request started being processed.\n- `resourceVersionMatch` set to any other value or unset\n Invalid error is returned.\n\nDefaults to true if `resourceVersion=\"\"` or `resourceVersion=\"0\"` (for backward compatibility reasons) and to false otherwise.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_ManagedFieldsEntry(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ManagedFieldsEntry is a workflow-id, a FieldSet and the group version of the resource that the fieldset applies to.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "manager": { + SchemaProps: spec.SchemaProps{ + Description: "Manager is an identifier of the workflow managing these fields.", + Type: []string{"string"}, + Format: "", + }, + }, + "operation": { + SchemaProps: spec.SchemaProps{ + Description: "Operation is the type of operation which lead to this ManagedFieldsEntry being created. The only valid values for this field are 'Apply' and 'Update'.", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the version of this resource that this field set applies to. The format is \"group/version\" just like the top-level APIVersion field. It is necessary to track the version of a field set because it cannot be automatically converted.", + Type: []string{"string"}, + Format: "", + }, + }, + "time": { + SchemaProps: spec.SchemaProps{ + Description: "Time is the timestamp of when the ManagedFields entry was added. The timestamp will also be updated if a field is added, the manager changes any of the owned fields value or removes a field. The timestamp does not update when a field is removed from the entry because another manager took it over.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "fieldsType": { + SchemaProps: spec.SchemaProps{ + Description: "FieldsType is the discriminator for the different fields format and version. There is currently only one possible value: \"FieldsV1\"", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldsV1": { + SchemaProps: spec.SchemaProps{ + Description: "FieldsV1 holds the first JSON version format as described in the \"FieldsV1\" type.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.FieldsV1"), + }, + }, + "subresource": { + SchemaProps: spec.SchemaProps{ + Description: "Subresource is the name of the subresource used to update that object, or empty string if the object was updated through the main resource. The value of this field is used to distinguish between managers, even if they share the same name. For example, a status update will be distinct from a regular update using the same manager name. Note that the APIVersion field is not related to the Subresource field and it always corresponds to the version of the main resource.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.FieldsV1", "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_pkg_apis_meta_v1_MicroTime(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "MicroTime is version of Time with microsecond level precision.", + Type: metav1.MicroTime{}.OpenAPISchemaType(), + Format: metav1.MicroTime{}.OpenAPISchemaFormat(), + }, + }, + } +} + +func schema_pkg_apis_meta_v1_ObjectMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectMeta is metadata that all persisted resources must have, which includes all objects users must create.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name must be unique within a namespace. Is required when creating resources, although some resources may allow a client to request the generation of an appropriate name automatically. Name is primarily intended for creation idempotence and configuration definition. Cannot be updated. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names#names", + Type: []string{"string"}, + Format: "", + }, + }, + "generateName": { + SchemaProps: spec.SchemaProps{ + Description: "GenerateName is an optional prefix, used by the server, to generate a unique name ONLY IF the Name field has not been provided. If this field is used, the name returned to the client will be different than the name passed. This value will also be combined with a unique suffix. The provided value has the same validation rules as the Name field, and may be truncated by the length of the suffix required to make the value unique on the server.\n\nIf this field is specified and the generated name exists, the server will return a 409.\n\nApplied only if Name is not specified. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#idempotency", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace defines the space within which each name must be unique. An empty namespace is equivalent to the \"default\" namespace, but \"default\" is the canonical representation. Not all objects are required to be scoped to a namespace - the value of this field for those objects will be empty.\n\nMust be a DNS_LABEL. Cannot be updated. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces", + Type: []string{"string"}, + Format: "", + }, + }, + "selfLink": { + SchemaProps: spec.SchemaProps{ + Description: "Deprecated: selfLink is a legacy read-only field that is no longer populated by the system.", + Type: []string{"string"}, + Format: "", + }, + }, + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID is the unique in time and space value for this object. It is typically generated by the server on successful creation of a resource and is not allowed to change on PUT operations.\n\nPopulated by the system. Read-only. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names#uids", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "An opaque value that represents the internal version of this object that can be used by clients to determine when objects have changed. May be used for optimistic concurrency, change detection, and the watch operation on a resource or set of resources. Clients must treat these values as opaque and passed unmodified back to the server. They may only be valid for a particular resource or set of resources.\n\nPopulated by the system. Read-only. Value must be treated as opaque by clients and . More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#concurrency-control-and-consistency", + Type: []string{"string"}, + Format: "", + }, + }, + "generation": { + SchemaProps: spec.SchemaProps{ + Description: "A sequence number representing a specific generation of the desired state. Populated by the system. Read-only.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "creationTimestamp": { + SchemaProps: spec.SchemaProps{ + Description: "CreationTimestamp is a timestamp representing the server time when this object was created. It is not guaranteed to be set in happens-before order across separate operations. Clients may not set this value. It is represented in RFC3339 form and is in UTC.\n\nPopulated by the system. Read-only. Null for lists. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "deletionTimestamp": { + SchemaProps: spec.SchemaProps{ + Description: "DeletionTimestamp is RFC 3339 date and time at which this resource will be deleted. This field is set by the server when a graceful deletion is requested by the user, and is not directly settable by a client. The resource is expected to be deleted (no longer visible from resource lists, and not reachable by name) after the time in this field, once the finalizers list is empty. As long as the finalizers list contains items, deletion is blocked. Once the deletionTimestamp is set, this value may not be unset or be set further into the future, although it may be shortened or the resource may be deleted prior to this time. For example, a user may request that a pod is deleted in 30 seconds. The Kubelet will react by sending a graceful termination signal to the containers in the pod. After that 30 seconds, the Kubelet will send a hard termination signal (SIGKILL) to the container and after cleanup, remove the pod from the API. In the presence of network partitions, this object may still exist after this timestamp, until an administrator or automated process can determine the resource is fully terminated. If not set, graceful deletion of the object has not been requested.\n\nPopulated by the system when a graceful deletion is requested. Read-only. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "deletionGracePeriodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Number of seconds allowed for this object to gracefully terminate before it will be removed from the system. Only set when deletionTimestamp is also set. May only be shortened. Read-only.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "labels": { + SchemaProps: spec.SchemaProps{ + Description: "Map of string keys and values that can be used to organize and categorize (scope and select) objects. May match selectors of replication controllers and services. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/labels", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "annotations": { + SchemaProps: spec.SchemaProps{ + Description: "Annotations is an unstructured key value map stored with a resource that may be set by external tools to store and retrieve arbitrary metadata. They are not queryable and should be preserved when modifying objects. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/annotations", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "ownerReferences": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "uid", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "uid", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of objects depended by this object. If ALL objects in the list have been deleted, this object will be garbage collected. If this object is managed by a controller, then an entry in this list will point to this controller, with the controller field set to true. There cannot be more than one managing controller.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference"), + }, + }, + }, + }, + }, + "finalizers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "set", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Must be empty before the object is deleted from the registry. Each entry is an identifier for the responsible component that will remove the entry from the list. If the deletionTimestamp of the object is non-nil, entries in this list can only be removed. Finalizers may be processed and removed in any order. Order is NOT enforced because it introduces significant risk of stuck finalizers. finalizers is a shared field, any actor with permission can reorder it. If the finalizer list is processed in order, then this can lead to a situation in which the component responsible for the first finalizer in the list is waiting for a signal (field value, external system, or other) produced by a component responsible for a finalizer later in the list, resulting in a deadlock. Without enforced ordering finalizers are free to order amongst themselves and are not vulnerable to ordering changes in the list.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "managedFields": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ManagedFields maps workflow-id and version to the set of fields that are managed by that workflow. This is mostly for internal housekeeping, and users typically shouldn't need to set or understand this field. A workflow can be the user's name, a controller's name, or the name of a specific apply path like \"ci-cd\". The set of fields is always in the version that the workflow used when modifying the object.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ManagedFieldsEntry"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ManagedFieldsEntry", "k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_pkg_apis_meta_v1_OwnerReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "OwnerReference contains enough information to let you identify an owning object. An owning object must be in the same namespace as the dependent, or be cluster-scoped, so there is no namespace field.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "API version of the referent.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind of the referent. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names#uids", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "controller": { + SchemaProps: spec.SchemaProps{ + Description: "If true, this reference points to the managing controller.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "blockOwnerDeletion": { + SchemaProps: spec.SchemaProps{ + Description: "If true, AND if the owner has the \"foregroundDeletion\" finalizer, then the owner cannot be deleted from the key-value store until this reference is removed. See https://kubernetes.io/docs/concepts/architecture/garbage-collection/#foreground-deletion for how the garbage collector interacts with this field and enforces the foreground deletion. Defaults to false. To set this field, a user needs \"delete\" permission of the owner, otherwise 422 (Unprocessable Entity) will be returned.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"apiVersion", "kind", "name", "uid"}, + }, + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_PartialObjectMetadata(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients to get access to a particular ObjectMeta schema without knowing the details of the version.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ObjectMeta"}, + } +} + +func schema_pkg_apis_meta_v1_PartialObjectMetadataList(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PartialObjectMetadataList contains a list of objects containing only their metadata", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Description: "items contains each of the included items.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.PartialObjectMetadata"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "k8s.io/apimachinery/pkg/apis/meta/v1.PartialObjectMetadata"}, + } +} + +func schema_pkg_apis_meta_v1_Patch(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Patch is provided to give a concrete name and type to the Kubernetes PATCH request body.", + Type: []string{"object"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_PatchOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PatchOptions may be provided when patching an API object. PatchOptions is meant to be a superset of UpdateOptions.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "dryRun": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "force": { + SchemaProps: spec.SchemaProps{ + Description: "Force is going to \"force\" Apply requests. It means user will re-acquire conflicting fields owned by other people. Force flag must be unset for non-apply patch requests.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "fieldManager": { + SchemaProps: spec.SchemaProps{ + Description: "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint. This field is required for apply requests (application/apply-patch) but optional for non-apply patch types (JsonPatch, MergePatch, StrategicMergePatch).", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldValidation": { + SchemaProps: spec.SchemaProps{ + Description: "fieldValidation instructs the server on how to handle objects in the request (POST/PUT/PATCH) containing unknown or duplicate fields. Valid values are: - Ignore: This will ignore any unknown fields that are silently dropped from the object, and will ignore all but the last duplicate field that the decoder encounters. This is the default behavior prior to v1.23. - Warn: This will send a warning via the standard warning response header for each unknown field that is dropped from the object, and for each duplicate field that is encountered. The request will still succeed if there are no other errors, and will only persist the last of any duplicate fields. This is the default in v1.23+ - Strict: This will fail the request with a BadRequest error if any unknown fields would be dropped from the object, or if any duplicate fields are present. The error returned from the server will contain all unknown and duplicate fields encountered.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_Preconditions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Preconditions must be fulfilled before an operation (update, delete, etc.) is carried out.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the target UID.", + Type: []string{"string"}, + Format: "", + }, + }, + "resourceVersion": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the target ResourceVersion", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_RootPaths(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "RootPaths lists the paths available at root. For example: \"/healthz\", \"/apis\".", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "paths": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "paths are the paths available at root.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"paths"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_ServerAddressByClientCIDR(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServerAddressByClientCIDR helps the client to determine the server address that they should use, depending on the clientCIDR that they match.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "clientCIDR": { + SchemaProps: spec.SchemaProps{ + Description: "The CIDR with which clients can match their IP to figure out the server address that they should use.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "serverAddress": { + SchemaProps: spec.SchemaProps{ + Description: "Address of this server, suitable for a client that matches the above CIDR. This can be a hostname, hostname:port, IP or IP:port.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"clientCIDR", "serverAddress"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_Status(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Status is a return value for calls that don't return other objects.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the operation. One of: \"Success\" or \"Failure\". More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#spec-and-status", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human-readable description of the status of this operation.", + Type: []string{"string"}, + Format: "", + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "A machine-readable description of why this operation is in the \"Failure\" status. If this value is empty there is no information available. A Reason clarifies an HTTP status code but does not override it.", + Type: []string{"string"}, + Format: "", + }, + }, + "details": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Extended data associated with the reason. Each reason may define its own extended details. This field is optional and the data returned is not guaranteed to conform to any schema except that defined by the reason type.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.StatusDetails"), + }, + }, + "code": { + SchemaProps: spec.SchemaProps{ + Description: "Suggested HTTP return code for this status, 0 if not set.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "k8s.io/apimachinery/pkg/apis/meta/v1.StatusDetails"}, + } +} + +func schema_pkg_apis_meta_v1_StatusCause(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "StatusCause provides more information about an api.Status failure, including cases when multiple errors are encountered.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "A machine-readable description of the cause of the error. If this value is empty there is no information available.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human-readable description of the cause of the error. This field may be presented as-is to a reader.", + Type: []string{"string"}, + Format: "", + }, + }, + "field": { + SchemaProps: spec.SchemaProps{ + Description: "The field of the resource that has caused this error, as named by its JSON serialization. May include dot and postfix notation for nested attributes. Arrays are zero-indexed. Fields may appear more than once in an array of causes due to fields having multiple errors. Optional.\n\nExamples:\n \"name\" - the field \"name\" on the current resource\n \"items[0].name\" - the field \"name\" on the first array entry in \"items\"", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_StatusDetails(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "StatusDetails is a set of additional properties that MAY be set by the server to provide additional information about a response. The Reason field of a Status object defines what attributes will be set. Clients must ignore fields that do not match the defined type of each attribute, and should assume that any attribute may be empty, invalid, or under defined.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The name attribute of the resource associated with the status StatusReason (when there is a single name which can be described).", + Type: []string{"string"}, + Format: "", + }, + }, + "group": { + SchemaProps: spec.SchemaProps{ + Description: "The group attribute of the resource associated with the status StatusReason.", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "The kind attribute of the resource associated with the status StatusReason. On some operations may differ from the requested resource Kind. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "uid": { + SchemaProps: spec.SchemaProps{ + Description: "UID of the resource. (when there is a single resource which can be described). More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names#uids", + Type: []string{"string"}, + Format: "", + }, + }, + "causes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The Causes array includes more details associated with the StatusReason failure. Not all StatusReasons may provide detailed causes.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.StatusCause"), + }, + }, + }, + }, + }, + "retryAfterSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the time in seconds before the operation should be retried. Some errors may indicate the client must take an alternate action - for those errors this field may indicate how long to wait before taking the alternate action.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.StatusCause"}, + } +} + +func schema_pkg_apis_meta_v1_Table(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Table is a tabular representation of a set of API resources. The server transforms the object into a set of preferred columns for quickly reviewing the objects.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta"), + }, + }, + "columnDefinitions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "columnDefinitions describes each column in the returned items array. The number of cells per row will always match the number of column definitions.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.TableColumnDefinition"), + }, + }, + }, + }, + }, + "rows": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "rows is the list of items in the table.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.TableRow"), + }, + }, + }, + }, + }, + }, + Required: []string{"columnDefinitions", "rows"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.ListMeta", "k8s.io/apimachinery/pkg/apis/meta/v1.TableColumnDefinition", "k8s.io/apimachinery/pkg/apis/meta/v1.TableRow"}, + } +} + +func schema_pkg_apis_meta_v1_TableColumnDefinition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TableColumnDefinition contains information about a column returned in the Table.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name is a human readable name for the column.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type is an OpenAPI type definition for this column, such as number, integer, string, or array. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "format": { + SchemaProps: spec.SchemaProps{ + Description: "format is an optional OpenAPI type modifier for this column. A format modifies the type and imposes additional rules, like date or time formatting for a string. The 'name' format is applied to the primary identifier column which has type 'string' to assist in clients identifying column is the resource name. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Description: "description is a human readable description of this column.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "priority": { + SchemaProps: spec.SchemaProps{ + Description: "priority is an integer defining the relative importance of this column compared to others. Lower numbers are considered higher priority. Columns that may be omitted in limited space scenarios should be given a higher priority.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"name", "type", "format", "description", "priority"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_TableOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TableOptions are used when a Table is requested by the caller.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "includeObject": { + SchemaProps: spec.SchemaProps{ + Description: "includeObject decides whether to include each object along with its columnar information. Specifying \"None\" will return no object, specifying \"Object\" will return the full object contents, and specifying \"Metadata\" (the default) will return the object's metadata in the PartialObjectMetadata kind in version v1beta1 of the meta.k8s.io API group.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_TableRow(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TableRow is an individual row in a table.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "cells": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "cells will be as wide as the column definitions array and may contain strings, numbers (float64 or int64), booleans, simple maps, lists, or null. See the type field of the column definition for a more detailed description.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Format: "", + }, + }, + }, + }, + }, + "conditions": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "conditions describe additional status of a row that are relevant for a human user. These conditions apply to the row, not to the object, and will be specific to table output. The only defined condition type is 'Completed', for a row that indicates a resource that has run to completion and can be given less visual priority.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.TableRowCondition"), + }, + }, + }, + }, + }, + "object": { + SchemaProps: spec.SchemaProps{ + Description: "This field contains the requested additional information about each object based on the includeObject policy when requesting the Table. If \"None\", this field is empty, if \"Object\" this will be the default serialization of the object for the current API version, and if \"Metadata\" (the default) will contain the object metadata. Check the returned kind and apiVersion of the object before parsing. The media type of the object will always match the enclosing list - if this as a JSON table, these will be JSON encoded objects.", + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + Required: []string{"cells"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.TableRowCondition", "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_pkg_apis_meta_v1_TableRowCondition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TableRowCondition allows a row to be marked with additional information.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of row condition. The only defined value is 'Completed' indicating that the object this row represents has reached a completed state and may be given less visual priority than other rows. Clients are not required to honor any conditions but should be consistent where possible about handling the conditions.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "(brief) machine readable reason for the condition's last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "Human readable message indicating details about last transition.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_Time(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Time is a wrapper around time.Time which supports correct marshaling to YAML and JSON. Wrappers are provided for many of the factory methods that the time package offers.", + Type: metav1.Time{}.OpenAPISchemaType(), + Format: metav1.Time{}.OpenAPISchemaFormat(), + }, + }, + } +} + +func schema_pkg_apis_meta_v1_Timestamp(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Timestamp is a struct that is equivalent to Time, but intended for protobuf marshalling/unmarshalling. It is generated into a serialization that matches Time. Do not use in Go structs.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "seconds": { + SchemaProps: spec.SchemaProps{ + Description: "Represents seconds of UTC time since Unix epoch 1970-01-01T00:00:00Z. Must be from 0001-01-01T00:00:00Z to 9999-12-31T23:59:59Z inclusive.", + Default: 0, + Type: []string{"integer"}, + Format: "int64", + }, + }, + "nanos": { + SchemaProps: spec.SchemaProps{ + Description: "Non-negative fractions of a second at nanosecond resolution. Negative second values with fractions must still have non-negative nanos values that count forward in time. Must be from 0 to 999,999,999 inclusive. This field may be limited in precision depending on context.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"seconds", "nanos"}, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_TypeMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypeMeta describes an individual object in an API response or request with strings representing the type of the object and its API schema version. Structures that are versioned or persisted should inline TypeMeta.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_UpdateOptions(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "UpdateOptions may be provided when updating an API object. All fields in UpdateOptions should also be present in PatchOptions.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "dryRun": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "fieldManager": { + SchemaProps: spec.SchemaProps{ + Description: "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint.", + Type: []string{"string"}, + Format: "", + }, + }, + "fieldValidation": { + SchemaProps: spec.SchemaProps{ + Description: "fieldValidation instructs the server on how to handle objects in the request (POST/PUT/PATCH) containing unknown or duplicate fields. Valid values are: - Ignore: This will ignore any unknown fields that are silently dropped from the object, and will ignore all but the last duplicate field that the decoder encounters. This is the default behavior prior to v1.23. - Warn: This will send a warning via the standard warning response header for each unknown field that is dropped from the object, and for each duplicate field that is encountered. The request will still succeed if there are no other errors, and will only persist the last of any duplicate fields. This is the default in v1.23+ - Strict: This will fail the request with a BadRequest error if any unknown fields would be dropped from the object, or if any duplicate fields are present. The error returned from the server will contain all unknown and duplicate fields encountered.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_pkg_apis_meta_v1_WatchEvent(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Event represents a single event to a watched resource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "object": { + SchemaProps: spec.SchemaProps{ + Description: "Object is:\n * If Type is Added or Modified: the new state of the object.\n * If Type is Deleted: the state of the object immediately before deletion.\n * If Type is Error: *Status is recommended; other types may make sense\n depending on context.", + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + Required: []string{"type", "object"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_k8sio_apimachinery_pkg_runtime_RawExtension(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "RawExtension is used to hold extensions in external versions.\n\nTo use this, make a field which has RawExtension as its type in your external, versioned struct, and Object in your internal struct. You also need to register your various plugin types.\n\n// Internal package:\n\n\ttype MyAPIObject struct {\n\t\truntime.TypeMeta `json:\",inline\"`\n\t\tMyPlugin runtime.Object `json:\"myPlugin\"`\n\t}\n\n\ttype PluginA struct {\n\t\tAOption string `json:\"aOption\"`\n\t}\n\n// External package:\n\n\ttype MyAPIObject struct {\n\t\truntime.TypeMeta `json:\",inline\"`\n\t\tMyPlugin runtime.RawExtension `json:\"myPlugin\"`\n\t}\n\n\ttype PluginA struct {\n\t\tAOption string `json:\"aOption\"`\n\t}\n\n// On the wire, the JSON will look something like this:\n\n\t{\n\t\t\"kind\":\"MyAPIObject\",\n\t\t\"apiVersion\":\"v1\",\n\t\t\"myPlugin\": {\n\t\t\t\"kind\":\"PluginA\",\n\t\t\t\"aOption\":\"foo\",\n\t\t},\n\t}\n\nSo what happens? Decode first uses json or yaml to unmarshal the serialized data into your external MyAPIObject. That causes the raw JSON to be stored, but not unpacked. The next step is to copy (using pkg/conversion) into the internal struct. The runtime package's DefaultScheme has conversion functions installed which will unpack the JSON stored in RawExtension, turning it into the correct object type, and storing it in the Object. (TODO: In the case where the object is of an unknown type, a runtime.Unknown object will be created and stored.)", + Type: []string{"object"}, + }, + }, + } +} + +func schema_k8sio_apimachinery_pkg_runtime_TypeMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypeMeta is shared by all top level objects. The proper way to use it is to inline it in your type, like this:\n\n\ttype MyAwesomeAPIObject struct {\n\t runtime.TypeMeta `json:\",inline\"`\n\t ... // other fields\n\t}\n\nfunc (obj *MyAwesomeAPIObject) SetGroupVersionKind(gvk *metav1.GroupVersionKind) { metav1.UpdateTypeMeta(obj,gvk) }; GroupVersionKind() *GroupVersionKind\n\nTypeMeta is provided here for convenience. You may use it directly from this package or define your own with the same fields.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_k8sio_apimachinery_pkg_runtime_Unknown(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Unknown allows api objects with unknown types to be passed-through. This can be used to deal with the API objects from a plug-in. Unknown objects still have functioning TypeMeta features-- kind, version, etc. metadata and field mutatation.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "ContentEncoding": { + SchemaProps: spec.SchemaProps{ + Description: "ContentEncoding is encoding used to encode 'Raw' data. Unspecified means no encoding.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "ContentType": { + SchemaProps: spec.SchemaProps{ + Description: "ContentType is serialization method used to serialize 'Raw'. Unspecified means ContentTypeJSON.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"ContentEncoding", "ContentType"}, + }, + }, + } +} + +func schema_apimachinery_pkg_util_intstr_IntOrString(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.EmbedOpenAPIDefinitionIntoV2Extension(common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "IntOrString is a type that can hold an int32 or a string. When used in JSON or YAML marshalling and unmarshalling, it produces or consumes the inner type. This allows you to have, for example, a JSON field that can accept a name or number.", + OneOf: common.GenerateOpenAPIV3OneOfSchema(intstr.IntOrString{}.OpenAPIV3OneOfTypes()), + Format: intstr.IntOrString{}.OpenAPISchemaFormat(), + }, + }, + }, common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "IntOrString is a type that can hold an int32 or a string. When used in JSON or YAML marshalling and unmarshalling, it produces or consumes the inner type. This allows you to have, for example, a JSON field that can accept a name or number.", + Type: intstr.IntOrString{}.OpenAPISchemaType(), + Format: intstr.IntOrString{}.OpenAPISchemaFormat(), + }, + }, + }) +} + +func schema_k8sio_apimachinery_pkg_version_Info(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Info contains versioning information. how we'll want to distribute that information.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "major": { + SchemaProps: spec.SchemaProps{ + Description: "Major is the major version of the binary version", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "minor": { + SchemaProps: spec.SchemaProps{ + Description: "Minor is the minor version of the binary version", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "emulationMajor": { + SchemaProps: spec.SchemaProps{ + Description: "EmulationMajor is the major version of the emulation version", + Type: []string{"string"}, + Format: "", + }, + }, + "emulationMinor": { + SchemaProps: spec.SchemaProps{ + Description: "EmulationMinor is the minor version of the emulation version", + Type: []string{"string"}, + Format: "", + }, + }, + "minCompatibilityMajor": { + SchemaProps: spec.SchemaProps{ + Description: "MinCompatibilityMajor is the major version of the minimum compatibility version", + Type: []string{"string"}, + Format: "", + }, + }, + "minCompatibilityMinor": { + SchemaProps: spec.SchemaProps{ + Description: "MinCompatibilityMinor is the minor version of the minimum compatibility version", + Type: []string{"string"}, + Format: "", + }, + }, + "gitVersion": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "gitCommit": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "gitTreeState": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "buildDate": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "goVersion": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "compiler": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "platform": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"major", "minor", "gitVersion", "gitCommit", "gitTreeState", "buildDate", "goVersion", "compiler", "platform"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_CAPIClusterInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "provider": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "clusterName": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"provider", "namespace", "clusterName"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_CertificatePrivateKey(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "CertificatePrivateKey contains configuration options for private keys used by the Certificate controller. This allows control of how private keys are rotated.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "encoding": { + SchemaProps: spec.SchemaProps{ + Description: "The private key cryptography standards (PKCS) encoding for this certificate's private key to be encoded in. If provided, allowed values are \"pkcs1\" and \"pkcs8\" standing for PKCS#1 and PKCS#8, respectively. Defaults to PKCS#1 if not specified. See here for the difference between the formats: https://stackoverflow.com/a/48960291", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_CertificateSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "alias": { + SchemaProps: spec.SchemaProps{ + Description: "Alias represents the identifier of the certificate.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "issuerRef": { + SchemaProps: spec.SchemaProps{ + Description: "IssuerRef is a reference to a Certificate Issuer.", + Ref: ref("k8s.io/api/core/v1.TypedLocalObjectReference"), + }, + }, + "secretName": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the k8s secret name that holds the certificates. Default to --cert.", + Type: []string{"string"}, + Format: "", + }, + }, + "subject": { + SchemaProps: spec.SchemaProps{ + Description: "Full X509 name specification (https://golang.org/pkg/crypto/x509/pkix/#Name).", + Ref: ref("kmodules.xyz/client-go/api/v1.X509Subject"), + }, + }, + "duration": { + SchemaProps: spec.SchemaProps{ + Description: "Certificate default Duration", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), + }, + }, + "renewBefore": { + SchemaProps: spec.SchemaProps{ + Description: "Certificate renew before expiration duration\n\nDeprecated use `ReconfigureTLS` type OpsRequest instead.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), + }, + }, + "dnsNames": { + SchemaProps: spec.SchemaProps{ + Description: "DNSNames is a list of subject alt names to be used on the Certificate.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "ipAddresses": { + SchemaProps: spec.SchemaProps{ + Description: "IPAddresses is a list of IP addresses to be used on the Certificate", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "uris": { + SchemaProps: spec.SchemaProps{ + Description: "URIs is a list of URI subjectAltNames to be set on the Certificate.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "emailAddresses": { + SchemaProps: spec.SchemaProps{ + Description: "EmailAddresses is a list of email subjectAltNames to be set on the Certificate.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "privateKey": { + SchemaProps: spec.SchemaProps{ + Description: "Options to control private keys used for the Certificate.", + Ref: ref("kmodules.xyz/client-go/api/v1.CertificatePrivateKey"), + }, + }, + }, + Required: []string{"alias"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.TypedLocalObjectReference", "k8s.io/apimachinery/pkg/apis/meta/v1.Duration", "kmodules.xyz/client-go/api/v1.CertificatePrivateKey", "kmodules.xyz/client-go/api/v1.X509Subject"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterClaimFeatures(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "enabledFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "externallyManagedFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "disabledFeatures": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterClaimInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "clusterMetadata": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ClusterInfo"), + }, + }, + }, + Required: []string{"clusterMetadata"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.ClusterInfo"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ClusterInfo used in ace-installer", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "uid": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "clusterManagers": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "capi": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/client-go/api/v1.CAPIClusterInfo"), + }, + }, + }, + Required: []string{"uid", "name", "clusterManagers"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.CAPIClusterInfo"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ClusterMetadata(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "uid": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "displayName": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "provider": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "ownerID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "ownerType": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "apiEndpoint": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "caBundle": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "managerID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "hubClusterID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "cloudServiceAuthMode": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "mode": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"uid"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_Condition(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Condition defines an observation of a object operational state.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of condition in CamelCase or in foo.example.com/CamelCase. Many .condition.type values are consistent across resources like Available, but because arbitrary util can be useful (see .node.status.util), the ability to deconflict is important.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status of the condition, one of True, False, Unknown.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "observedGeneration": { + SchemaProps: spec.SchemaProps{ + Description: "If set, this represents the .metadata.generation that the condition was set based upon. For instance, if .metadata.generation is currently 12, but the .status.condition[x].observedGeneration is 9, the condition is out of date with respect to the current state of the instance.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "severity": { + SchemaProps: spec.SchemaProps{ + Description: "Severity provides an explicit classification of Reason code, so the users or machines can immediately understand the current situation and act accordingly. The Severity field MUST be set only when Status=False.", + Type: []string{"string"}, + Format: "", + }, + }, + "lastTransitionTime": { + SchemaProps: spec.SchemaProps{ + Description: "Last time the condition transitioned from one status to another. This should be when the underlying condition changed. If that is not known, then using the time when the API field changed is acceptable.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Time"), + }, + }, + "reason": { + SchemaProps: spec.SchemaProps{ + Description: "The reason for the condition's last transition in CamelCase. The specific API may choose whether this field is considered a guaranteed API. This field may not be empty.", + Type: []string{"string"}, + Format: "", + }, + }, + "message": { + SchemaProps: spec.SchemaProps{ + Description: "A human-readable message indicating details about the transition. This field may be empty.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type", "status", "lastTransitionTime"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Time"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_HealthCheckSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "HealthCheckSpec defines attributes of the health check", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "periodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "How often (in seconds) to perform the health check. Default to 10 seconds. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "timeoutSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Number of seconds after which the probe times out. Defaults to 10 second. Minimum value is 1. It should be less than the periodSeconds.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "failureThreshold": { + SchemaProps: spec.SchemaProps{ + Description: "Minimum consecutive failures for the health check to be considered failed after having succeeded. Defaults to 1. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "disableWriteCheck": { + SchemaProps: spec.SchemaProps{ + Description: "Whether to disable write check on database. Defaults to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ImageInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "image": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "lineages": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.Lineage"), + }, + }, + }, + }, + }, + "pullCredentials": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/client-go/api/v1.PullCredentials"), + }, + }, + }, + Required: []string{"image"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.Lineage", "kmodules.xyz/client-go/api/v1.PullCredentials"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_Lineage(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "chain": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ObjectInfo"), + }, + }, + }, + }, + }, + "containers": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.ObjectInfo"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ObjectID(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ObjectInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "resource": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ResourceID"), + }, + }, + "ref": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ObjectReference"), + }, + }, + }, + Required: []string{"resource", "ref"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.ObjectReference", "kmodules.xyz/client-go/api/v1.ResourceID"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectReference contains enough information to let you inspect or modify the referred object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_PullCredentials(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "namespace": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "serviceAccountName": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "secretRefs": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + }, + Required: []string{"namespace"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ReadonlyHealthCheckSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ReadonlyHealthCheckSpec defines attributes of the health check using only read-only checks", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "periodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "How often (in seconds) to perform the health check. Default to 10 seconds. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "timeoutSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Number of seconds after which the probe times out. Defaults to 10 second. Minimum value is 1. It should be less than the periodSeconds.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "failureThreshold": { + SchemaProps: spec.SchemaProps{ + Description: "Minimum consecutive failures for the health check to be considered failed after having succeeded. Defaults to 1. Minimum value is 1.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_ResourceID(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ResourceID identifies a resource", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "group": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name is the plural name of the resource to serve. It must match the name of the CustomResourceDefinition-registration too: plural.group and it must be all lowercase.", + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is the serialized kind of the resource. It is normally CamelCase and singular.", + Type: []string{"string"}, + Format: "", + }, + }, + "scope": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"group"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_TLSConfig(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "issuerRef": { + SchemaProps: spec.SchemaProps{ + Description: "IssuerRef is a reference to a Certificate Issuer.", + Ref: ref("k8s.io/api/core/v1.TypedLocalObjectReference"), + }, + }, + "certificates": { + SchemaProps: spec.SchemaProps{ + Description: "Certificate provides server and/or client certificate options used by application pods. These options are passed to a cert-manager Certificate object. xref: https://github.com/jetstack/cert-manager/blob/v0.16.0/pkg/apis/certmanager/v1beta1/types_certificate.go#L82-L162", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.CertificateSpec"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.TypedLocalObjectReference", "kmodules.xyz/client-go/api/v1.CertificateSpec"}, + } +} + +func schema_kmodulesxyz_client_go_api_v1_TimeOfDay(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TimeOfDay is a wrapper around time.Time which supports correct marshaling to YAML and JSON. Wrappers are provided for many of the factory methods that the time package offers.", + Type: apiv1.TimeOfDay{}.OpenAPISchemaType(), + Format: apiv1.TimeOfDay{}.OpenAPISchemaFormat(), + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_TypeReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypeReference represents an object type.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiGroup": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_TypedObjectReference(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "TypedObjectReference represents a typed namespaced object.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "apiGroup": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "kind": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/namespaces/", + Type: []string{"string"}, + Format: "", + }, + }, + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name of the referent. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name"}, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_X509Subject(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "X509Subject Full X509 name specification", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "organizations": { + SchemaProps: spec.SchemaProps{ + Description: "Organizations to be used on the Certificate.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "countries": { + SchemaProps: spec.SchemaProps{ + Description: "Countries to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "organizationalUnits": { + SchemaProps: spec.SchemaProps{ + Description: "Organizational Units to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "localities": { + SchemaProps: spec.SchemaProps{ + Description: "Cities to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "provinces": { + SchemaProps: spec.SchemaProps{ + Description: "State/Provinces to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "streetAddresses": { + SchemaProps: spec.SchemaProps{ + Description: "Street addresses to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "postalCodes": { + SchemaProps: spec.SchemaProps{ + Description: "Postal codes to be used on the CertificateSpec.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "serialNumber": { + SchemaProps: spec.SchemaProps{ + Description: "Serial number to be used on the CertificateSpec.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_client_go_api_v1_stringSetMerger(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_ContainerRuntimeSettings(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Compute Resources required by container. Cannot be updated. More info: https://kubernetes.io/docs/concepts/configuration/manage-compute-resources-container/", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "livenessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container liveness. Container will be restarted if the probe fails. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "readinessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container service readiness. Container will be removed from service endpoints if the probe fails. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "lifecycle": { + SchemaProps: spec.SchemaProps{ + Description: "Actions that the management system should take in response to container lifecycle events. Cannot be updated.", + Ref: ref("k8s.io/api/core/v1.Lifecycle"), + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "Security options the pod should run with. More info: https://kubernetes.io/docs/concepts/policy/security-context/ More info: https://kubernetes.io/docs/tasks/configure-pod-container/security-context/", + Ref: ref("k8s.io/api/core/v1.SecurityContext"), + }, + }, + "nice": { + SchemaProps: spec.SchemaProps{ + Description: "Settings to configure `nice` to throttle the load on cpu. More info: http://kennystechtalk.blogspot.com/2015/04/throttling-cpu-usage-with-linux-cgroups.html More info: https://oakbytes.wordpress.com/2012/06/06/linux-scheduler-cfs-and-nice/", + Ref: ref("kmodules.xyz/offshoot-api/api/v1.NiceSettings"), + }, + }, + "ionice": { + SchemaProps: spec.SchemaProps{ + Description: "Settings to configure `ionice` to throttle the load on disk. More info: http://kennystechtalk.blogspot.com/2015/04/throttling-cpu-usage-with-linux-cgroups.html More info: https://oakbytes.wordpress.com/2012/06/06/linux-scheduler-cfs-and-nice/", + Ref: ref("kmodules.xyz/offshoot-api/api/v1.IONiceSettings"), + }, + }, + "envFrom": { + SchemaProps: spec.SchemaProps{ + Description: "List of sources to populate environment variables in the container. The keys defined within a source must be a C_IDENTIFIER. All invalid keys will be reported as an event when the container is starting. When a key exists in multiple sources, the value associated with the last source will take precedence. Values defined by an Env with a duplicate key will take precedence. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvFromSource"), + }, + }, + }, + }, + }, + "env": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of environment variables to set in the container. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvVar"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.EnvFromSource", "k8s.io/api/core/v1.EnvVar", "k8s.io/api/core/v1.Lifecycle", "k8s.io/api/core/v1.Probe", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.SecurityContext", "kmodules.xyz/offshoot-api/api/v1.IONiceSettings", "kmodules.xyz/offshoot-api/api/v1.NiceSettings"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_EphemeralVolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents an ephemeral volume that is handled by a normal storage driver.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumeClaimTemplate": { + SchemaProps: spec.SchemaProps{ + Description: "Will be used to create a stand-alone PVC to provision the volume. The pod in which this EphemeralVolumeSource is embedded will be the owner of the PVC, i.e. the PVC will be deleted together with the pod. The name of the PVC will be `-` where `` is the name from the `PodSpec.Volumes` array entry. Pod validation will reject the pod if the concatenated name is not valid for a PVC (for example, too long).\n\nAn existing PVC with that name that is not owned by the pod will *not* be used for the pod to avoid using an unrelated volume by mistake. Starting the pod is then blocked until the unrelated PVC is removed. If such a pre-created PVC is meant to be used by the pod, the PVC has to updated with an owner reference to the pod once the pod exists. Normally this should not be necessary, but it may be useful when manually reconstructing a broken cluster.\n\nThis field is read-only and no changes will be made by Kubernetes to the PVC after it has been created.\n\nRequired, must not be nil.", + Ref: ref("kmodules.xyz/offshoot-api/api/v1.PersistentVolumeClaimTemplate"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.PersistentVolumeClaimTemplate"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_Gateway(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "ip": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "hostname": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "services": { + SchemaProps: spec.SchemaProps{ + Description: "Services is an optional configuration for services used to expose database", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.NamedServiceStatus"), + }, + }, + }, + }, + }, + "ui": { + SchemaProps: spec.SchemaProps{ + Description: "UI is an optional list of database web uis", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.NamedURL"), + }, + }, + }, + }, + }, + }, + Required: []string{"name", "namespace"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.NamedServiceStatus", "kmodules.xyz/offshoot-api/api/v1.NamedURL"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_GatewayPort(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "GatewayPort contains information on Gateway service's port.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The name of this port within the gateway service.", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Description: "The port that will be exposed by the gateway service.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "backendServicePort": { + SchemaProps: spec.SchemaProps{ + Description: "Number of the port to access the backend service.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "nodePort": { + SchemaProps: spec.SchemaProps{ + Description: "The port on each node on which this gateway service is exposed when type is NodePort or LoadBalancer.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"port"}, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_IONiceSettings(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "https://linux.die.net/man/1/ionice", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "class": { + SchemaProps: spec.SchemaProps{ + Type: []string{"integer"}, + Format: "int32", + }, + }, + "classData": { + SchemaProps: spec.SchemaProps{ + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_NamedServiceStatus(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "alias": { + SchemaProps: spec.SchemaProps{ + Description: "Alias represents the identifier of the service.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "ports": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.GatewayPort"), + }, + }, + }, + }, + }, + }, + Required: []string{"alias", "ports"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.GatewayPort"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_NamedURL(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "alias": { + SchemaProps: spec.SchemaProps{ + Description: "Alias represents the identifier of the service. This should match the db ui chart name", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "url": { + SchemaProps: spec.SchemaProps{ + Description: "URL of the database ui", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.GatewayPort"), + }, + }, + "helmRelease": { + SchemaProps: spec.SchemaProps{ + Description: "HelmRelease is the name of the helm release used to deploy this ui The name format is typically -", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + Required: []string{"alias", "url", "port"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.LocalObjectReference", "kmodules.xyz/offshoot-api/api/v1.GatewayPort"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_NiceSettings(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "https://linux.die.net/man/1/nice", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "adjustment": { + SchemaProps: spec.SchemaProps{ + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_ObjectMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectMeta is metadata that all persisted resources must have, which includes all objects users must create.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "labels": { + SchemaProps: spec.SchemaProps{ + Description: "Map of string keys and values that can be used to organize and categorize (scope and select) objects. May match selectors of replication controllers and services. More info: http://kubernetes.io/docs/user-guide/labels", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "annotations": { + SchemaProps: spec.SchemaProps{ + Description: "Annotations is an unstructured key value map stored with a resource that may be set by external tools to store and retrieve arbitrary metadata. They are not queryable and should be preserved when modifying objects. More info: http://kubernetes.io/docs/user-guide/annotations", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PartialObjectMeta(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ObjectMeta is metadata that all persisted resources must have, which includes all objects users must create.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "Name must be unique within a namespace. Is required when creating resources, although some resources may allow a client to request the generation of an appropriate name automatically. Name is primarily intended for creation idempotence and configuration definition. Cannot be updated. More info: http://kubernetes.io/docs/user-guide/identifiers#names", + Type: []string{"string"}, + Format: "", + }, + }, + "generateName": { + SchemaProps: spec.SchemaProps{ + Description: "GenerateName is an optional prefix, used by the server, to generate a unique name ONLY IF the Name field has not been provided. If this field is used, the name returned to the client will be different than the name passed. This value will also be combined with a unique suffix. The provided value has the same validation rules as the Name field, and may be truncated by the length of the suffix required to make the value unique on the server.\n\nIf this field is specified and the generated name exists, the server will NOT return a 409 - instead, it will either return 201 Created or 500 with Reason ServerTimeout indicating a unique name could not be found in the time allotted, and the client should retry (optionally after the time indicated in the Retry-After header).\n\nApplied only if Name is not specified. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#idempotency", + Type: []string{"string"}, + Format: "", + }, + }, + "namespace": { + SchemaProps: spec.SchemaProps{ + Description: "Namespace defines the space within each name must be unique. An empty namespace is equivalent to the \"default\" namespace, but \"default\" is the canonical representation. Not all objects are required to be scoped to a namespace - the value of this field for those objects will be empty.\n\nMust be a DNS_LABEL. Cannot be updated. More info: http://kubernetes.io/docs/user-guide/namespaces", + Type: []string{"string"}, + Format: "", + }, + }, + "labels": { + SchemaProps: spec.SchemaProps{ + Description: "Map of string keys and values that can be used to organize and categorize (scope and select) objects. May match selectors of replication controllers and services. More info: http://kubernetes.io/docs/user-guide/labels", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "annotations": { + SchemaProps: spec.SchemaProps{ + Description: "Annotations is an unstructured key value map stored with a resource that may be set by external tools to store and retrieve arbitrary metadata. They are not queryable and should be preserved when modifying objects. More info: http://kubernetes.io/docs/user-guide/annotations", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "ownerReferences": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "uid", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of objects depended by this object. If ALL objects in the list have been deleted, this object will be garbage collected. If this object is managed by a controller, then an entry in this list will point to this controller, with the controller field set to true. There cannot be more than one managing controller.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.OwnerReference"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PersistentVolumeClaim(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaim is a user's request for and claim to a persistent volume", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.PartialObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Spec defines the desired characteristics of a volume requested by a pod author. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimSpec"), + }, + }, + "status": { + SchemaProps: spec.SchemaProps{ + Description: "Status represents the current information/status of a persistent volume claim. Read-only. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimStatus"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaimSpec", "k8s.io/api/core/v1.PersistentVolumeClaimStatus", "kmodules.xyz/offshoot-api/api/v1.PartialObjectMeta"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PersistentVolumeClaimTemplate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PersistentVolumeClaimTemplate is used to produce PersistentVolumeClaim objects as part of an EphemeralVolumeSource.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "May contain labels and annotations that will be copied into the PVC when creating it. No other fields are allowed and will be rejected during validation.", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.PartialObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "The specification for the PersistentVolumeClaim. The entire content is copied unchanged into the PVC that gets created from this template. The same fields as in a PersistentVolumeClaim are also valid here.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimSpec"), + }, + }, + }, + Required: []string{"spec"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.PersistentVolumeClaimSpec", "kmodules.xyz/offshoot-api/api/v1.PartialObjectMeta"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PodRuntimeSettings(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "podLabels": { + SchemaProps: spec.SchemaProps{ + Description: "PodLabels are the labels that will be attached with the respective Pod", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "podAnnotations": { + SchemaProps: spec.SchemaProps{ + Description: "PodAnnotations are the annotations that will be attached with the respective Pod", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "nodeSelector": { + SchemaProps: spec.SchemaProps{ + Description: "NodeSelector is a selector which must be true for the pod to fit on a node. Selector which must match a node's labels for the pod to be scheduled on that node. More info: https://kubernetes.io/docs/concepts/configuration/assign-pod-node/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "serviceAccountName": { + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountName is the name of the ServiceAccount to use to run this pod. More info: https://kubernetes.io/docs/tasks/configure-pod-container/configure-service-account/", + Type: []string{"string"}, + Format: "", + }, + }, + "serviceAccountAnnotations": { + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountAnnotations are the annotations that will be attached with the respective ServiceAccount", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "automountServiceAccountToken": { + SchemaProps: spec.SchemaProps{ + Description: "AutomountServiceAccountToken indicates whether a service account token should be automatically mounted.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "nodeName": { + SchemaProps: spec.SchemaProps{ + Description: "NodeName is a request to schedule this pod onto a specific node. If it is non-empty, the scheduler simply schedules this pod onto that node, assuming that it fits resource requirements.", + Type: []string{"string"}, + Format: "", + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "Security options the pod should run with. More info: https://kubernetes.io/docs/concepts/policy/security-context/ More info: https://kubernetes.io/docs/tasks/configure-pod-container/security-context/", + Ref: ref("k8s.io/api/core/v1.PodSecurityContext"), + }, + }, + "imagePullSecrets": { + SchemaProps: spec.SchemaProps{ + Description: "ImagePullSecrets is an optional list of references to secrets in the same namespace to use for pulling any of the images used by this PodRuntimeSettings. If specified, these secrets will be passed to individual puller implementations for them to use. For example, in the case of docker, only DockerConfig type secrets are honored. More info: https://kubernetes.io/docs/concepts/containers/images#specifying-imagepullsecrets-on-a-pod", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + "affinity": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's scheduling constraints", + Ref: ref("k8s.io/api/core/v1.Affinity"), + }, + }, + "schedulerName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod will be dispatched by specified scheduler. If not specified, the pod will be dispatched by default scheduler.", + Type: []string{"string"}, + Format: "", + }, + }, + "tolerations": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's tolerations.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Toleration"), + }, + }, + }, + }, + }, + "priorityClassName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, indicates the pod's priority. \"system-node-critical\" and \"system-cluster-critical\" are two special keywords which indicate the highest priorities with the former being the highest priority. Any other name must be defined by creating a PriorityClass object with that name. If not specified, the pod priority will be default or zero if there is no default.", + Type: []string{"string"}, + Format: "", + }, + }, + "priority": { + SchemaProps: spec.SchemaProps{ + Description: "The priority value. Various system components use this field to find the priority of the pod. When Priority Admission Controller is enabled, it prevents users from setting this field. The admission controller populates this field from PriorityClassName. The higher the value, the higher the priority.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "readinessGates": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, all readiness gates will be evaluated for pod readiness. A pod is ready when all its containers are ready AND all conditions specified in the readiness gates have status equal to \"True\" More info: https://git.k8s.io/enhancements/keps/sig-network/0007-pod-ready%2B%2B.md", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.PodReadinessGate"), + }, + }, + }, + }, + }, + "runtimeClassName": { + SchemaProps: spec.SchemaProps{ + Description: "RuntimeClassName refers to a RuntimeClass object in the node.k8s.io group, which should be used to run this pod. If no RuntimeClass resource matches the named class, the pod will not be run. If unset or empty, the \"legacy\" RuntimeClass will be used, which is an implicit class with an empty definition that uses the default runtime handler. More info: https://git.k8s.io/enhancements/keps/sig-node/runtime-class.md This is an alpha feature and may change in the future.", + Type: []string{"string"}, + Format: "", + }, + }, + "enableServiceLinks": { + SchemaProps: spec.SchemaProps{ + Description: "EnableServiceLinks indicates whether information about services should be injected into pod's environment variables, matching the syntax of Docker links. Optional: Defaults to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "topologySpreadConstraints": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "topologyKey", + "whenUnsatisfiable", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "topologyKey", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "TopologySpreadConstraints describes how a group of pods ought to spread across topology domains. Scheduler will schedule pods in a way which abides by the constraints. All topologySpreadConstraints are ANDed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.TopologySpreadConstraint"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Affinity", "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/api/core/v1.PodReadinessGate", "k8s.io/api/core/v1.PodSecurityContext", "k8s.io/api/core/v1.Toleration", "k8s.io/api/core/v1.TopologySpreadConstraint"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PodSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "volumes": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge,retainKeys", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of volumes that can be mounted by containers belonging to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.Volume"), + }, + }, + }, + }, + }, + "initContainers": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "List of initialization containers belonging to the pod. Init containers are executed in order prior to containers being started. If any init container fails, the pod is considered to have failed and is handled according to its restartPolicy. The name for an init container or normal container must be unique among all containers. Init containers may not have Lifecycle actions, Readiness probes, or Liveness probes. The resourceRequirements of an init container are taken into account during scheduling by finding the highest request/limit for each resource type, and then using the max of of that value or the sum of the normal containers. Limits are applied to init containers in a similar fashion. Init containers cannot currently be added or removed. Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/init-containers/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Container"), + }, + }, + }, + }, + }, + "terminationGracePeriodSeconds": { + SchemaProps: spec.SchemaProps{ + Description: "Optional duration in seconds the pod needs to terminate gracefully. May be decreased in delete request. Value must be non-negative integer. The value zero indicates stop immediately via the kill signal (no opportunity to shut down). If this value is nil, the default grace period will be used instead. The grace period is the duration in seconds after the processes running in the pod are sent a termination signal and the time when the processes are forcibly halted with a kill signal. Set this value longer than the expected cleanup time for your process. Defaults to 30 seconds.", + Type: []string{"integer"}, + Format: "int64", + }, + }, + "dnsPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "Set DNS policy for the pod. Defaults to \"ClusterFirst\". Valid values are 'ClusterFirstWithHostNet', 'ClusterFirst', 'Default' or 'None'. DNS parameters given in DNSConfig will be merged with the policy selected with DNSPolicy. To have DNS options set along with hostNetwork, you have to specify DNS policy explicitly to 'ClusterFirstWithHostNet'.\n\nPossible enum values:\n - `\"ClusterFirst\"` indicates that the pod should use cluster DNS first unless hostNetwork is true, if it is available, then fall back on the default (as determined by kubelet) DNS settings.\n - `\"ClusterFirstWithHostNet\"` indicates that the pod should use cluster DNS first, if it is available, then fall back on the default (as determined by kubelet) DNS settings.\n - `\"Default\"` indicates that the pod should use the default (as determined by kubelet) DNS settings.\n - `\"None\"` indicates that the pod should use empty DNS settings. DNS parameters such as nameservers and search paths should be defined via DNSConfig.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ClusterFirst", "ClusterFirstWithHostNet", "Default", "None"}, + }, + }, + "nodeSelector": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-map-type": "atomic", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "NodeSelector is a selector which must be true for the pod to fit on a node. Selector which must match a node's labels for the pod to be scheduled on that node. More info: https://kubernetes.io/docs/concepts/configuration/assign-pod-node/", + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "serviceAccountName": { + SchemaProps: spec.SchemaProps{ + Description: "ServiceAccountName is the name of the ServiceAccount to use to run this pod. More info: https://kubernetes.io/docs/tasks/configure-pod-container/configure-service-account/", + Type: []string{"string"}, + Format: "", + }, + }, + "hostNetwork": { + SchemaProps: spec.SchemaProps{ + Description: "Host networking requested for this pod. Use the host's network namespace. If this option is set, the ports that will be used must be specified. Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "hostPID": { + SchemaProps: spec.SchemaProps{ + Description: "Use the host's pid namespace. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "hostIPC": { + SchemaProps: spec.SchemaProps{ + Description: "Use the host's ipc namespace. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "shareProcessNamespace": { + SchemaProps: spec.SchemaProps{ + Description: "Share a single process namespace between all of the containers in a pod. When this is set containers will be able to view and signal processes from other containers in the same pod, and the first process in each container will not be assigned PID 1. HostPID and ShareProcessNamespace cannot both be set. Optional: Default to false.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "securityContext": { + SchemaProps: spec.SchemaProps{ + Description: "SecurityContext holds pod-level security attributes and common container settings. Optional: Defaults to empty. See type description for default values of each field.", + Ref: ref("k8s.io/api/core/v1.PodSecurityContext"), + }, + }, + "imagePullSecrets": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "name", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "ImagePullSecrets is an optional list of references to secrets in the same namespace to use for pulling any of the images used by this PodSpec. If specified, these secrets will be passed to individual puller implementations for them to use. More info: https://kubernetes.io/docs/concepts/containers/images#specifying-imagepullsecrets-on-a-pod", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + "affinity": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's scheduling constraints", + Ref: ref("k8s.io/api/core/v1.Affinity"), + }, + }, + "schedulerName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod will be dispatched by specified scheduler. If not specified, the pod will be dispatched by default scheduler.", + Type: []string{"string"}, + Format: "", + }, + }, + "tolerations": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, the pod's tolerations.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.Toleration"), + }, + }, + }, + }, + }, + "priorityClassName": { + SchemaProps: spec.SchemaProps{ + Description: "If specified, indicates the pod's priority. \"system-node-critical\" and \"system-cluster-critical\" are two special keywords which indicate the highest priorities with the former being the highest priority. Any other name must be defined by creating a PriorityClass object with that name. If not specified, the pod priority will be default or zero if there is no default.", + Type: []string{"string"}, + Format: "", + }, + }, + "priority": { + SchemaProps: spec.SchemaProps{ + Description: "The priority value. Various system components use this field to find the priority of the pod. When Priority Admission Controller is enabled, it prevents users from setting this field. The admission controller populates this field from PriorityClassName. The higher the value, the higher the priority.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "dnsConfig": { + SchemaProps: spec.SchemaProps{ + Description: "Specifies the DNS parameters of a pod. Parameters specified here will be merged to the generated DNS configuration based on DNSPolicy.", + Ref: ref("k8s.io/api/core/v1.PodDNSConfig"), + }, + }, + "runtimeClassName": { + SchemaProps: spec.SchemaProps{ + Description: "RuntimeClassName refers to a RuntimeClass object in the node.k8s.io group, which should be used to run this pod. If no RuntimeClass resource matches the named class, the pod will not be run. If unset or empty, the \"legacy\" RuntimeClass will be used, which is an implicit class with an empty definition that uses the default runtime handler. More info: https://git.k8s.io/enhancements/keps/sig-node/585-runtime-class", + Type: []string{"string"}, + Format: "", + }, + }, + "enableServiceLinks": { + SchemaProps: spec.SchemaProps{ + Description: "EnableServiceLinks indicates whether information about services should be injected into pod's environment variables, matching the syntax of Docker links. Optional: Defaults to true.", + Type: []string{"boolean"}, + Format: "", + }, + }, + "topologySpreadConstraints": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-list-map-keys": []interface{}{ + "topologyKey", + "whenUnsatisfiable", + }, + "x-kubernetes-list-type": "map", + "x-kubernetes-patch-merge-key": "topologyKey", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "TopologySpreadConstraints describes how a group of pods ought to spread across topology domains. Scheduler will schedule pods in a way which abides by the constraints. All topologySpreadConstraints are ANDed.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.TopologySpreadConstraint"), + }, + }, + }, + }, + }, + "args": { + SchemaProps: spec.SchemaProps{ + Description: "Arguments to the entrypoint. The docker image's CMD is used if this is not provided. Variable references $(VAR_NAME) are expanded using the container's environment. If a variable cannot be resolved, the reference in the input string will be unchanged. The $(VAR_NAME) syntax can be escaped with a double $$, ie: $$(VAR_NAME). Escaped references will never be expanded, regardless of whether the variable exists or not. Cannot be updated. More info: https://kubernetes.io/docs/tasks/inject-data-application/define-command-argument-container/#running-a-command-in-a-shell", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "env": { + SchemaProps: spec.SchemaProps{ + Description: "List of environment variables to set in the container. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.EnvVar"), + }, + }, + }, + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Compute Resources required by the sidecar container.", + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.ResourceRequirements"), + }, + }, + "livenessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container liveness. Container will be restarted if the probe fails. Controllers may set default LivenessProbe if no liveness probe is provided. To ignore defaulting, set the value to empty LivenessProbe \"{}\". Cannot be updated. More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "readinessProbe": { + SchemaProps: spec.SchemaProps{ + Description: "Periodic probe of container service readiness. Container will be removed from service endpoints if the probe fails. Cannot be updated. Controllers may set default ReadinessProbe if no readyness probe is provided. To ignore defaulting, set the value to empty ReadynessProbe \"{}\". More info: https://kubernetes.io/docs/concepts/workloads/pods/pod-lifecycle#container-probes", + Ref: ref("k8s.io/api/core/v1.Probe"), + }, + }, + "lifecycle": { + SchemaProps: spec.SchemaProps{ + Description: "Actions that the management system should take in response to container lifecycle events. Cannot be updated.", + Ref: ref("k8s.io/api/core/v1.Lifecycle"), + }, + }, + "containerSecurityContext": { + SchemaProps: spec.SchemaProps{ + Description: "Security options the pod should run with. More info: https://kubernetes.io/docs/concepts/policy/security-context/ More info: https://kubernetes.io/docs/tasks/configure-pod-container/security-context/", + Ref: ref("k8s.io/api/core/v1.SecurityContext"), + }, + }, + "volumeMounts": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "mountPath", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "Pod volumes to mount into the container's filesystem. Cannot be updated.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/api/core/v1.VolumeMount"), + }, + }, + }, + }, + }, + "podPlacementPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "PodPlacementPolicy is the reference of the podPlacementPolicy", + Ref: ref("k8s.io/api/core/v1.LocalObjectReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.Affinity", "k8s.io/api/core/v1.Container", "k8s.io/api/core/v1.EnvVar", "k8s.io/api/core/v1.Lifecycle", "k8s.io/api/core/v1.LocalObjectReference", "k8s.io/api/core/v1.PodDNSConfig", "k8s.io/api/core/v1.PodSecurityContext", "k8s.io/api/core/v1.Probe", "k8s.io/api/core/v1.ResourceRequirements", "k8s.io/api/core/v1.SecurityContext", "k8s.io/api/core/v1.Toleration", "k8s.io/api/core/v1.TopologySpreadConstraint", "k8s.io/api/core/v1.VolumeMount", "kmodules.xyz/offshoot-api/api/v1.Volume"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_PodTemplateSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "PodTemplateSpec describes the data a pod should have when created from a template", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ObjectMeta"), + }, + }, + "controller": { + SchemaProps: spec.SchemaProps{ + Description: "Workload controller's metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Specification of the desired behavior of the pod. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.PodSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.ObjectMeta", "kmodules.xyz/offshoot-api/api/v1.PodSpec"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_RuntimeSettings(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "pod": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/offshoot-api/api/v1.PodRuntimeSettings"), + }, + }, + "container": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ContainerRuntimeSettings"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.ContainerRuntimeSettings", "kmodules.xyz/offshoot-api/api/v1.PodRuntimeSettings"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_ServicePort(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServicePort contains information on service's port.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "The name of this port within the service. This must be a DNS_LABEL. All ports within a ServiceSpec must have unique names. This maps to the 'Name' field in EndpointPort objects. Optional if only one ServicePort is defined on this service.", + Type: []string{"string"}, + Format: "", + }, + }, + "port": { + SchemaProps: spec.SchemaProps{ + Description: "The port that will be exposed by this service.", + Default: 0, + Type: []string{"integer"}, + Format: "int32", + }, + }, + "nodePort": { + SchemaProps: spec.SchemaProps{ + Description: "The port on each node on which this service is exposed when type=NodePort or LoadBalancer. Usually assigned by the system. If specified, it will be allocated to the service if unused or else creation of the service will fail. Default is to auto-allocate a port if the ServiceType of this Service requires one. More info: https://kubernetes.io/docs/concepts/services-networking/service/#type-nodeport", + Type: []string{"integer"}, + Format: "int32", + }, + }, + }, + Required: []string{"port"}, + }, + }, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceSpec describes the attributes that a user creates on a service.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ports": { + VendorExtensible: spec.VendorExtensible{ + Extensions: spec.Extensions{ + "x-kubernetes-patch-merge-key": "port", + "x-kubernetes-patch-strategy": "merge", + }, + }, + SchemaProps: spec.SchemaProps{ + Description: "The list of ports that are exposed by this service. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ServicePort"), + }, + }, + }, + }, + }, + "clusterIP": { + SchemaProps: spec.SchemaProps{ + Description: "clusterIP is the IP address of the service and is usually assigned randomly by the master. If an address is specified manually and is not in use by others, it will be allocated to the service; otherwise, creation of the service will fail. This field can not be changed through updates. Valid values are \"None\", empty string (\"\"), or a valid IP address. \"None\" can be specified for headless services when proxying is not required. Only applies to types ClusterIP, NodePort, and LoadBalancer. Ignored if type is ExternalName. More info: https://kubernetes.io/docs/concepts/services-networking/service/#virtual-ips-and-service-proxies", + Type: []string{"string"}, + Format: "", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "type determines how the Service is exposed. Defaults to ClusterIP. Valid options are ExternalName, ClusterIP, NodePort, and LoadBalancer. \"ExternalName\" maps to the specified externalName. \"ClusterIP\" allocates a cluster-internal IP address for load-balancing to endpoints. Endpoints are determined by the selector or if that is not specified, by manual construction of an Endpoints object. If clusterIP is \"None\", no virtual IP is allocated and the endpoints are published as a set of endpoints rather than a stable IP. \"NodePort\" builds on ClusterIP and allocates a port on every node which routes to the clusterIP. \"LoadBalancer\" builds on NodePort and creates an external load-balancer (if supported in the current cloud) which routes to the clusterIP. More info: https://kubernetes.io/docs/concepts/services-networking/service/#publishing-services---service-types\n\nPossible enum values:\n - `\"ClusterIP\"` means a service will only be accessible inside the cluster, via the cluster IP.\n - `\"ExternalName\"` means a service consists of only a reference to an external name that kubedns or equivalent will return as a CNAME record, with no exposing or proxying of any pods involved.\n - `\"LoadBalancer\"` means a service will be exposed via an external load balancer (if the cloud provider supports it), in addition to 'NodePort' type.\n - `\"NodePort\"` means a service will be exposed on one port of every node, in addition to 'ClusterIP' type.", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"ClusterIP", "ExternalName", "LoadBalancer", "NodePort"}, + }, + }, + "externalIPs": { + SchemaProps: spec.SchemaProps{ + Description: "externalIPs is a list of IP addresses for which nodes in the cluster will also accept traffic for this service. These IPs are not managed by Kubernetes. The user is responsible for ensuring that traffic arrives at a node with this IP. A common example is external load-balancers that are not part of the Kubernetes system.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "loadBalancerIP": { + SchemaProps: spec.SchemaProps{ + Description: "Only applies to Service Type: LoadBalancer LoadBalancer will get created with the IP specified in this field. This feature depends on whether the underlying cloud-provider supports specifying the loadBalancerIP when a load balancer is created. This field will be ignored if the cloud-provider does not support the feature.", + Type: []string{"string"}, + Format: "", + }, + }, + "loadBalancerSourceRanges": { + SchemaProps: spec.SchemaProps{ + Description: "If specified and supported by the platform, this will restrict traffic through the cloud-provider load-balancer will be restricted to the specified client IPs. This field will be ignored if the cloud-provider does not support the feature.\" More info: https://kubernetes.io/docs/tasks/access-application-cluster/configure-cloud-provider-firewall/", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "externalTrafficPolicy": { + SchemaProps: spec.SchemaProps{ + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Type: []string{"string"}, + Format: "", + Enum: []interface{}{"Cluster", "Local"}, + }, + }, + "healthCheckNodePort": { + SchemaProps: spec.SchemaProps{ + Description: "healthCheckNodePort specifies the healthcheck nodePort for the service. If not specified, HealthCheckNodePort is created by the service api backend with the allocated nodePort. Will use user-specified nodePort value if specified by the client. Only effects when Type is set to LoadBalancer and ExternalTrafficPolicy is set to Local.", + Type: []string{"integer"}, + Format: "int32", + }, + }, + "sessionAffinityConfig": { + SchemaProps: spec.SchemaProps{ + Description: "sessionAffinityConfig contains the configurations of session affinity.", + Ref: ref("k8s.io/api/core/v1.SessionAffinityConfig"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.SessionAffinityConfig", "kmodules.xyz/offshoot-api/api/v1.ServicePort"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_ServiceTemplateSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "ServiceTemplateSpec describes the data a service should have when created from a template", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Description: "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ObjectMeta"), + }, + }, + "spec": { + SchemaProps: spec.SchemaProps{ + Description: "Specification of the desired behavior of the service. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#spec-and-status", + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/offshoot-api/api/v1.ServiceSpec"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/offshoot-api/api/v1.ObjectMeta", "kmodules.xyz/offshoot-api/api/v1.ServiceSpec"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_Volume(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Volume represents a named volume in a pod that may be accessed by any container in the pod.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Description: "name of the volume. Must be a DNS_LABEL and unique within the pod. More info: https://kubernetes.io/docs/concepts/overview/working-with-objects/names/#names", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a pre-existing file or directory on the host machine that is directly exposed to the container. This is generally used for system agents or other privileged things that are allowed to see the host machine. Most containers will NOT need this. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "emptyDir": { + SchemaProps: spec.SchemaProps{ + Description: "emptyDir represents a temporary directory that shares a pod's lifetime. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Ref: ref("k8s.io/api/core/v1.EmptyDirVolumeSource"), + }, + }, + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "secret": { + SchemaProps: spec.SchemaProps{ + Description: "secret represents a secret that should populate this volume. More info: https://kubernetes.io/docs/concepts/storage/volumes#secret", + Ref: ref("k8s.io/api/core/v1.SecretVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host that shares a pod's lifetime More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://examples.k8s.io/volumes/iscsi/README.md", + Ref: ref("k8s.io/api/core/v1.ISCSIVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs mount on the host that shares a pod's lifetime. More info: https://examples.k8s.io/volumes/glusterfs/README.md", + Ref: ref("k8s.io/api/core/v1.GlusterfsVolumeSource"), + }, + }, + "persistentVolumeClaim": { + SchemaProps: spec.SchemaProps{ + Description: "persistentVolumeClaimVolumeSource represents a reference to a PersistentVolumeClaim in the same namespace. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. More info: https://examples.k8s.io/volumes/rbd/README.md", + Ref: ref("k8s.io/api/core/v1.RBDVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin.", + Ref: ref("k8s.io/api/core/v1.FlexVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime", + Ref: ref("k8s.io/api/core/v1.CephFSVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine. This depends on the Flocker control service being running", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "downwardAPI": { + SchemaProps: spec.SchemaProps{ + Description: "downwardAPI represents downward API about the pod that should populate this volume", + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod.", + Ref: ref("k8s.io/api/core/v1.AzureFileVolumeSource"), + }, + }, + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "configMap represents a configMap that should populate this volume", + Ref: ref("k8s.io/api/core/v1.ConfigMapVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "projected": { + SchemaProps: spec.SchemaProps{ + Description: "projected items for all in one resources secrets, configmaps, and downward API", + Ref: ref("k8s.io/api/core/v1.ProjectedVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes.", + Ref: ref("k8s.io/api/core/v1.ScaleIOVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume attached and mounted on Kubernetes nodes.", + Ref: ref("k8s.io/api/core/v1.StorageOSVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi (Container Storage Interface) represents ephemeral storage that is handled by certain external CSI drivers (Beta feature).", + Ref: ref("k8s.io/api/core/v1.CSIVolumeSource"), + }, + }, + "ephemeral": { + SchemaProps: spec.SchemaProps{ + Description: "ephemeral represents a volume that is handled by a cluster storage driver. The volume's lifecycle is tied to the pod that defines it - it will be created before the pod starts, and deleted when the pod is removed.\n\nUse this if: a) the volume is only needed while the pod runs, b) features of normal volumes like restoring from snapshot or capacity\n tracking are needed,\nc) the storage driver is specified through a storage class, and d) the storage driver supports dynamic volume provisioning through\n a PersistentVolumeClaim (see EphemeralVolumeSource for more\n information on the connection between this volume type\n and PersistentVolumeClaim).\n\nUse PersistentVolumeClaim or one of the vendor-specific APIs for volumes that persist for longer than the lifecycle of an individual pod.\n\nUse CSI for light-weight local ephemeral volumes if the CSI driver is meant to be used that way - see the documentation of the driver for more information.\n\nA pod can use both types of ephemeral volumes and persistent volumes at the same time.", + Ref: ref("kmodules.xyz/offshoot-api/api/v1.EphemeralVolumeSource"), + }, + }, + }, + Required: []string{"name"}, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFileVolumeSource", "k8s.io/api/core/v1.CSIVolumeSource", "k8s.io/api/core/v1.CephFSVolumeSource", "k8s.io/api/core/v1.CinderVolumeSource", "k8s.io/api/core/v1.ConfigMapVolumeSource", "k8s.io/api/core/v1.DownwardAPIVolumeSource", "k8s.io/api/core/v1.EmptyDirVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GlusterfsVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.ProjectedVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDVolumeSource", "k8s.io/api/core/v1.ScaleIOVolumeSource", "k8s.io/api/core/v1.SecretVolumeSource", "k8s.io/api/core/v1.StorageOSVolumeSource", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource", "kmodules.xyz/offshoot-api/api/v1.EphemeralVolumeSource"}, + } +} + +func schema_kmodulesxyz_offshoot_api_api_v1_VolumeSource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "Represents the source of a volume to mount. Only one of its members may be specified.", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "hostPath": { + SchemaProps: spec.SchemaProps{ + Description: "hostPath represents a pre-existing file or directory on the host machine that is directly exposed to the container. This is generally used for system agents or other privileged things that are allowed to see the host machine. Most containers will NOT need this. More info: https://kubernetes.io/docs/concepts/storage/volumes#hostpath", + Ref: ref("k8s.io/api/core/v1.HostPathVolumeSource"), + }, + }, + "emptyDir": { + SchemaProps: spec.SchemaProps{ + Description: "emptyDir represents a temporary directory that shares a pod's lifetime. More info: https://kubernetes.io/docs/concepts/storage/volumes#emptydir", + Ref: ref("k8s.io/api/core/v1.EmptyDirVolumeSource"), + }, + }, + "gcePersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "gcePersistentDisk represents a GCE Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes#gcepersistentdisk", + Ref: ref("k8s.io/api/core/v1.GCEPersistentDiskVolumeSource"), + }, + }, + "awsElasticBlockStore": { + SchemaProps: spec.SchemaProps{ + Description: "awsElasticBlockStore represents an AWS Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://kubernetes.io/docs/concepts/storage/volumes#awselasticblockstore", + Ref: ref("k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource"), + }, + }, + "secret": { + SchemaProps: spec.SchemaProps{ + Description: "secret represents a secret that should populate this volume. More info: https://kubernetes.io/docs/concepts/storage/volumes#secret", + Ref: ref("k8s.io/api/core/v1.SecretVolumeSource"), + }, + }, + "nfs": { + SchemaProps: spec.SchemaProps{ + Description: "nfs represents an NFS mount on the host that shares a pod's lifetime More info: https://kubernetes.io/docs/concepts/storage/volumes#nfs", + Ref: ref("k8s.io/api/core/v1.NFSVolumeSource"), + }, + }, + "iscsi": { + SchemaProps: spec.SchemaProps{ + Description: "iscsi represents an ISCSI Disk resource that is attached to a kubelet's host machine and then exposed to the pod. More info: https://examples.k8s.io/volumes/iscsi/README.md", + Ref: ref("k8s.io/api/core/v1.ISCSIVolumeSource"), + }, + }, + "glusterfs": { + SchemaProps: spec.SchemaProps{ + Description: "glusterfs represents a Glusterfs mount on the host that shares a pod's lifetime. More info: https://examples.k8s.io/volumes/glusterfs/README.md", + Ref: ref("k8s.io/api/core/v1.GlusterfsVolumeSource"), + }, + }, + "persistentVolumeClaim": { + SchemaProps: spec.SchemaProps{ + Description: "persistentVolumeClaimVolumeSource represents a reference to a PersistentVolumeClaim in the same namespace. More info: https://kubernetes.io/docs/concepts/storage/persistent-volumes#persistentvolumeclaims", + Ref: ref("k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource"), + }, + }, + "rbd": { + SchemaProps: spec.SchemaProps{ + Description: "rbd represents a Rados Block Device mount on the host that shares a pod's lifetime. More info: https://examples.k8s.io/volumes/rbd/README.md", + Ref: ref("k8s.io/api/core/v1.RBDVolumeSource"), + }, + }, + "flexVolume": { + SchemaProps: spec.SchemaProps{ + Description: "flexVolume represents a generic volume resource that is provisioned/attached using an exec based plugin.", + Ref: ref("k8s.io/api/core/v1.FlexVolumeSource"), + }, + }, + "cinder": { + SchemaProps: spec.SchemaProps{ + Description: "cinder represents a cinder volume attached and mounted on kubelets host machine. More info: https://examples.k8s.io/mysql-cinder-pd/README.md", + Ref: ref("k8s.io/api/core/v1.CinderVolumeSource"), + }, + }, + "cephfs": { + SchemaProps: spec.SchemaProps{ + Description: "cephFS represents a Ceph FS mount on the host that shares a pod's lifetime", + Ref: ref("k8s.io/api/core/v1.CephFSVolumeSource"), + }, + }, + "flocker": { + SchemaProps: spec.SchemaProps{ + Description: "flocker represents a Flocker volume attached to a kubelet's host machine. This depends on the Flocker control service being running", + Ref: ref("k8s.io/api/core/v1.FlockerVolumeSource"), + }, + }, + "downwardAPI": { + SchemaProps: spec.SchemaProps{ + Description: "downwardAPI represents downward API about the pod that should populate this volume", + Ref: ref("k8s.io/api/core/v1.DownwardAPIVolumeSource"), + }, + }, + "fc": { + SchemaProps: spec.SchemaProps{ + Description: "fc represents a Fibre Channel resource that is attached to a kubelet's host machine and then exposed to the pod.", + Ref: ref("k8s.io/api/core/v1.FCVolumeSource"), + }, + }, + "azureFile": { + SchemaProps: spec.SchemaProps{ + Description: "azureFile represents an Azure File Service mount on the host and bind mount to the pod.", + Ref: ref("k8s.io/api/core/v1.AzureFileVolumeSource"), + }, + }, + "configMap": { + SchemaProps: spec.SchemaProps{ + Description: "configMap represents a configMap that should populate this volume", + Ref: ref("k8s.io/api/core/v1.ConfigMapVolumeSource"), + }, + }, + "vsphereVolume": { + SchemaProps: spec.SchemaProps{ + Description: "vsphereVolume represents a vSphere volume attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource"), + }, + }, + "quobyte": { + SchemaProps: spec.SchemaProps{ + Description: "quobyte represents a Quobyte mount on the host that shares a pod's lifetime", + Ref: ref("k8s.io/api/core/v1.QuobyteVolumeSource"), + }, + }, + "azureDisk": { + SchemaProps: spec.SchemaProps{ + Description: "azureDisk represents an Azure Data Disk mount on the host and bind mount to the pod.", + Ref: ref("k8s.io/api/core/v1.AzureDiskVolumeSource"), + }, + }, + "photonPersistentDisk": { + SchemaProps: spec.SchemaProps{ + Description: "photonPersistentDisk represents a PhotonController persistent disk attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource"), + }, + }, + "projected": { + SchemaProps: spec.SchemaProps{ + Description: "projected items for all in one resources secrets, configmaps, and downward API", + Ref: ref("k8s.io/api/core/v1.ProjectedVolumeSource"), + }, + }, + "portworxVolume": { + SchemaProps: spec.SchemaProps{ + Description: "portworxVolume represents a portworx volume attached and mounted on kubelets host machine", + Ref: ref("k8s.io/api/core/v1.PortworxVolumeSource"), + }, + }, + "scaleIO": { + SchemaProps: spec.SchemaProps{ + Description: "scaleIO represents a ScaleIO persistent volume attached and mounted on Kubernetes nodes.", + Ref: ref("k8s.io/api/core/v1.ScaleIOVolumeSource"), + }, + }, + "storageos": { + SchemaProps: spec.SchemaProps{ + Description: "storageOS represents a StorageOS volume attached and mounted on Kubernetes nodes.", + Ref: ref("k8s.io/api/core/v1.StorageOSVolumeSource"), + }, + }, + "csi": { + SchemaProps: spec.SchemaProps{ + Description: "csi (Container Storage Interface) represents ephemeral storage that is handled by certain external CSI drivers (Beta feature).", + Ref: ref("k8s.io/api/core/v1.CSIVolumeSource"), + }, + }, + "ephemeral": { + SchemaProps: spec.SchemaProps{ + Description: "ephemeral represents a volume that is handled by a cluster storage driver. The volume's lifecycle is tied to the pod that defines it - it will be created before the pod starts, and deleted when the pod is removed.\n\nUse this if: a) the volume is only needed while the pod runs, b) features of normal volumes like restoring from snapshot or capacity\n tracking are needed,\nc) the storage driver is specified through a storage class, and d) the storage driver supports dynamic volume provisioning through\n a PersistentVolumeClaim (see EphemeralVolumeSource for more\n information on the connection between this volume type\n and PersistentVolumeClaim).\n\nUse PersistentVolumeClaim or one of the vendor-specific APIs for volumes that persist for longer than the lifecycle of an individual pod.\n\nUse CSI for light-weight local ephemeral volumes if the CSI driver is meant to be used that way - see the documentation of the driver for more information.\n\nA pod can use both types of ephemeral volumes and persistent volumes at the same time.", + Ref: ref("kmodules.xyz/offshoot-api/api/v1.EphemeralVolumeSource"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/api/core/v1.AWSElasticBlockStoreVolumeSource", "k8s.io/api/core/v1.AzureDiskVolumeSource", "k8s.io/api/core/v1.AzureFileVolumeSource", "k8s.io/api/core/v1.CSIVolumeSource", "k8s.io/api/core/v1.CephFSVolumeSource", "k8s.io/api/core/v1.CinderVolumeSource", "k8s.io/api/core/v1.ConfigMapVolumeSource", "k8s.io/api/core/v1.DownwardAPIVolumeSource", "k8s.io/api/core/v1.EmptyDirVolumeSource", "k8s.io/api/core/v1.FCVolumeSource", "k8s.io/api/core/v1.FlexVolumeSource", "k8s.io/api/core/v1.FlockerVolumeSource", "k8s.io/api/core/v1.GCEPersistentDiskVolumeSource", "k8s.io/api/core/v1.GlusterfsVolumeSource", "k8s.io/api/core/v1.HostPathVolumeSource", "k8s.io/api/core/v1.ISCSIVolumeSource", "k8s.io/api/core/v1.NFSVolumeSource", "k8s.io/api/core/v1.PersistentVolumeClaimVolumeSource", "k8s.io/api/core/v1.PhotonPersistentDiskVolumeSource", "k8s.io/api/core/v1.PortworxVolumeSource", "k8s.io/api/core/v1.ProjectedVolumeSource", "k8s.io/api/core/v1.QuobyteVolumeSource", "k8s.io/api/core/v1.RBDVolumeSource", "k8s.io/api/core/v1.ScaleIOVolumeSource", "k8s.io/api/core/v1.SecretVolumeSource", "k8s.io/api/core/v1.StorageOSVolumeSource", "k8s.io/api/core/v1.VsphereVirtualDiskVolumeSource", "kmodules.xyz/offshoot-api/api/v1.EphemeralVolumeSource"}, + } +} + +func schema_resource_metadata_apis_editor_v1alpha1_EditorModel(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Description: "EditorModel loads the editor model, manifest and resources for an existing installation identified by its metadata. It is the aggregated-API equivalent of kubepack.dev/lib-app/pkg/editor.LoadResourceEditorModel (see chart_template.go loadEditorModel2).", + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "kind": { + SchemaProps: spec.SchemaProps{ + Description: "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#types-kinds", + Type: []string{"string"}, + Format: "", + }, + }, + "apiVersion": { + SchemaProps: spec.SchemaProps{ + Description: "APIVersion defines the versioned schema of this representation of an object. Servers should convert recognized schemas to the latest internal value, and may reject unrecognized values. More info: https://git.k8s.io/community/contributors/devel/sig-architecture/api-conventions.md#resources", + Type: []string{"string"}, + Format: "", + }, + }, + "request": { + SchemaProps: spec.SchemaProps{ + Description: "Request identifies the installation to load.", + Ref: ref("kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelRequest"), + }, + }, + "response": { + SchemaProps: spec.SchemaProps{ + Description: "Response holds the loaded editor template.", + Ref: ref("kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResponse"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelRequest", "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResponse"}, + } +} + +func schema_resource_metadata_apis_editor_v1alpha1_EditorModelRequest(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "metadata": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.Metadata"), + }, + }, + "values": { + SchemaProps: spec.SchemaProps{ + Description: "Values is the editor chart's values, fetched by the caller. The chart is pulled (getChart) by the caller because it can take longer than the aggregated apiserver request budget; kube-ui-server only does the fast in-cluster reconstruction from these values.", + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.RawExtension", "x-helm.dev/apimachinery/apis/releases/v1alpha1.Metadata"}, + } +} + +func schema_resource_metadata_apis_editor_v1alpha1_EditorModelResource(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "filename": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "key": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "data": { + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_resource_metadata_apis_editor_v1alpha1_EditorModelResponse(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "manifest": { + SchemaProps: spec.SchemaProps{ + Description: "Manifest is the rendered manifest of the existing installation.", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + SchemaProps: spec.SchemaProps{ + Description: "Values is the editor model (values) of the existing installation.", + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + "resources": { + SchemaProps: spec.SchemaProps{ + Description: "Resources holds the individual resources of the existing installation.", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResource"), + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.RawExtension", "kmodules.xyz/resource-metadata/apis/editor/v1alpha1.EditorModelResource"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_Action(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icon": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icons": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("x-helm.dev/apimachinery/apis/shared.ImageSpec"), + }, + }, + }, + }, + }, + "operationId": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "flow": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "disabled": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "editor": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + }, + Required: []string{"operationId", "flow", "disabled"}, + }, + }, + Dependencies: []string{ + "x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef", "x-helm.dev/apimachinery/apis/shared.ImageSpec"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ActionGroup(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icon": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.Action"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.Action"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ActionInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icon": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ActionTemplate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icon": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icons": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("x-helm.dev/apimachinery/apis/shared.ImageSpec"), + }, + }, + }, + }, + }, + "operationId": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "flow": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "disabledTemplate": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "editor": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + "enforceQuota": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "partOf": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"operationId", "flow", "enforceQuota"}, + }, + }, + Dependencies: []string{ + "x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef", "x-helm.dev/apimachinery/apis/shared.ImageSpec"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ActionTemplateGroup(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "icon": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "description": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "items": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ActionTemplate"), + }, + }, + }, + }, + }, + }, + Required: []string{"items"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.ActionTemplate"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_BootstrapPresets(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "offlineInstaller": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "image": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ImageRegistrySpec"), + }, + }, + "registry": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.RegistryInfo"), + }, + }, + "helm": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.HelmInfo"), + }, + }, + }, + Required: []string{"image", "registry", "helm"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.HelmInfo", "kmodules.xyz/resource-metadata/apis/shared.ImageRegistrySpec", "kmodules.xyz/resource-metadata/apis/shared.RegistryInfo"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_Dashboard(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "title": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "vars": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.DashboardVar"), + }, + }, + }, + }, + }, + "panels": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "if": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.If"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.DashboardVar", "kmodules.xyz/resource-metadata/apis/shared.If"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_DashboardVar(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "name": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "value": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"name", "value"}, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_DeploymentParameters(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "productID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "planID": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "chart": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_DistroSpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "openshift": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "ubi": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"openshift", "ubi"}, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_HelmInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "createNamespace": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "repositories": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.HelmRepository"), + }, + }, + }, + }, + }, + "releases": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.HelmRelease"), + }, + }, + }, + }, + }, + }, + Required: []string{"createNamespace", "repositories", "releases"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.HelmRelease", "kmodules.xyz/resource-metadata/apis/shared.HelmRepository"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_HelmRelease(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "enabled": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "version": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "values": { + SchemaProps: spec.SchemaProps{ + Ref: ref("k8s.io/apimachinery/pkg/runtime.RawExtension"), + }, + }, + }, + Required: []string{"enabled", "version"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/runtime.RawExtension"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_HelmRepository(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "url": { + SchemaProps: spec.SchemaProps{ + Description: "URL of the Helm repository, a valid URL contains at least a protocol and host.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "secretName": { + SchemaProps: spec.SchemaProps{ + Description: "SecretRef specifies the Secret containing authentication credentials for the HelmRepository. For HTTP/S basic auth the secret must contain 'username' and 'password' fields. For TLS the secret must contain a 'certFile' and 'keyFile', and/or 'caFile' fields.", + Type: []string{"string"}, + Format: "", + }, + }, + "interval": { + SchemaProps: spec.SchemaProps{ + Description: "Interval at which to check the URL for updates.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), + }, + }, + "timeout": { + SchemaProps: spec.SchemaProps{ + Description: "The timeout of index downloading, defaults to 60s.", + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.Duration"), + }, + }, + "type": { + SchemaProps: spec.SchemaProps{ + Description: "Type of the HelmRepository. When this field is set to \"oci\", the URL field value must be prefixed with \"oci://\".", + Type: []string{"string"}, + Format: "", + }, + }, + "provider": { + SchemaProps: spec.SchemaProps{ + Description: "Provider used for authentication, can be 'aws', 'azure', 'gcp' or 'generic'. This field is optional, and only taken into account if the .spec.type field is set to 'oci'. When not specified, defaults to 'generic'.", + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"url"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.Duration"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_If(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "condition": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "connected": { + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ResourceLocator"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.ResourceLocator"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ImageRegistrySpec(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "proxies": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.RegistryProxies"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.RegistryProxies"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_RegistryInfo(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "credentials": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "certs": { + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + AdditionalProperties: &spec.SchemaOrBool{ + Allows: true, + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + "imagePullSecrets": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_RegistryProxies(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "dockerHub": { + SchemaProps: spec.SchemaProps{ + Description: "company/bin:1.23", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "dockerLibrary": { + SchemaProps: spec.SchemaProps{ + Description: "alpine, nginx etc.", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "ghcr": { + SchemaProps: spec.SchemaProps{ + Description: "ghcr.io", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "quay": { + SchemaProps: spec.SchemaProps{ + Description: "quay.io", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "kubernetes": { + SchemaProps: spec.SchemaProps{ + Description: "registry.k8s.io", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "microsoft": { + SchemaProps: spec.SchemaProps{ + Description: "mcr.microsoft.com", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "appscode": { + SchemaProps: spec.SchemaProps{ + Description: "r.appscode.com", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "oracle": { + SchemaProps: spec.SchemaProps{ + Description: "container-registry.oracle.com", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "weaviate": { + SchemaProps: spec.SchemaProps{ + Description: "cr.weaviate.io", + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ResourceLocator(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "ref": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("k8s.io/apimachinery/pkg/apis/meta/v1.GroupKind"), + }, + }, + "query": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ResourceQuery"), + }, + }, + "impersonate": { + SchemaProps: spec.SchemaProps{ + Type: []string{"boolean"}, + Format: "", + }, + }, + }, + Required: []string{"ref", "query"}, + }, + }, + Dependencies: []string{ + "k8s.io/apimachinery/pkg/apis/meta/v1.GroupKind", "kmodules.xyz/resource-metadata/apis/shared.ResourceQuery"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_ResourceQuery(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "type": { + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + "byLabel": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + "raw": { + SchemaProps: spec.SchemaProps{ + Type: []string{"string"}, + Format: "", + }, + }, + }, + Required: []string{"type"}, + }, + }, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_SourceLocator(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "resource": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ResourceID"), + }, + }, + "ref": { + SchemaProps: spec.SchemaProps{ + Default: map[string]interface{}{}, + Ref: ref("kmodules.xyz/client-go/api/v1.ObjectReference"), + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/client-go/api/v1.ObjectReference", "kmodules.xyz/client-go/api/v1.ResourceID"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_UIParameterTemplate(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "options": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + "editor": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + "enforceQuota": { + SchemaProps: spec.SchemaProps{ + Default: false, + Type: []string{"boolean"}, + Format: "", + }, + }, + "actions": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ActionTemplateGroup"), + }, + }, + }, + }, + }, + "instanceLabelPaths": { + SchemaProps: spec.SchemaProps{ + Description: "app.kubernetes.io/instance label must be updated at these paths when refilling metadata", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + Required: []string{"enforceQuota"}, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.ActionTemplateGroup", "x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"}, + } +} + +func schema_kmodulesxyz_resource_metadata_apis_shared_UIParameters(ref common.ReferenceCallback) common.OpenAPIDefinition { + return common.OpenAPIDefinition{ + Schema: spec.Schema{ + SchemaProps: spec.SchemaProps{ + Type: []string{"object"}, + Properties: map[string]spec.Schema{ + "options": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + "editor": { + SchemaProps: spec.SchemaProps{ + Ref: ref("x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"), + }, + }, + "actions": { + SchemaProps: spec.SchemaProps{ + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Ref: ref("kmodules.xyz/resource-metadata/apis/shared.ActionGroup"), + }, + }, + }, + }, + }, + "instanceLabelPaths": { + SchemaProps: spec.SchemaProps{ + Description: "app.kubernetes.io/instance label must be updated at these paths when refilling metadata", + Type: []string{"array"}, + Items: &spec.SchemaOrArray{ + Schema: &spec.Schema{ + SchemaProps: spec.SchemaProps{ + Default: "", + Type: []string{"string"}, + Format: "", + }, + }, + }, + }, + }, + }, + }, + }, + Dependencies: []string{ + "kmodules.xyz/resource-metadata/apis/shared.ActionGroup", "x-helm.dev/apimachinery/apis/releases/v1alpha1.ChartSourceRef"}, + } +} diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/register.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/register.go new file mode 100644 index 000000000..39d62eca8 --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/register.go @@ -0,0 +1,62 @@ +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package v1alpha1 + +import ( + "kmodules.xyz/resource-metadata/apis/editor" + + metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" + "k8s.io/apimachinery/pkg/runtime" + "k8s.io/apimachinery/pkg/runtime/schema" +) + +var SchemeGroupVersion = schema.GroupVersion{Group: editor.GroupName, Version: "v1alpha1"} + +var ( + // TODO: move SchemeBuilder with zz_generated.deepcopy.go to k8s.io/api. + // localSchemeBuilder and AddToScheme will stay in k8s.io/kubernetes. + SchemeBuilder runtime.SchemeBuilder + localSchemeBuilder = &SchemeBuilder + AddToScheme = localSchemeBuilder.AddToScheme +) + +func init() { + // We only register manually written functions here. The registration of the + // generated functions takes place in the generated files. The separation + // makes the code compile even when the generated files are missing. + localSchemeBuilder.Register(addKnownTypes) +} + +// Resource takes an unqualified resource and returns a Group qualified GroupResource +func Resource(resource string) schema.GroupResource { + return SchemeGroupVersion.WithResource(resource).GroupResource() +} + +// Adds the list of known types to api.Scheme. +func addKnownTypes(scheme *runtime.Scheme) error { + scheme.AddKnownTypes( + SchemeGroupVersion, + &EditorModel{}, + ) + + scheme.AddKnownTypes( + SchemeGroupVersion, + &metav1.Status{}, + ) + metav1.AddToGroupVersion(scheme, SchemeGroupVersion) + return nil +} diff --git a/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/zz_generated.deepcopy.go b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/zz_generated.deepcopy.go new file mode 100644 index 000000000..c81b05b07 --- /dev/null +++ b/vendor/kmodules.xyz/resource-metadata/apis/editor/v1alpha1/zz_generated.deepcopy.go @@ -0,0 +1,132 @@ +//go:build !ignore_autogenerated +// +build !ignore_autogenerated + +/* +Copyright AppsCode Inc. and Contributors + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Code generated by deepcopy-gen. DO NOT EDIT. + +package v1alpha1 + +import ( + runtime "k8s.io/apimachinery/pkg/runtime" +) + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *EditorModel) DeepCopyInto(out *EditorModel) { + *out = *in + out.TypeMeta = in.TypeMeta + if in.Request != nil { + in, out := &in.Request, &out.Request + *out = new(EditorModelRequest) + (*in).DeepCopyInto(*out) + } + if in.Response != nil { + in, out := &in.Response, &out.Response + *out = new(EditorModelResponse) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EditorModel. +func (in *EditorModel) DeepCopy() *EditorModel { + if in == nil { + return nil + } + out := new(EditorModel) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *EditorModel) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *EditorModelRequest) DeepCopyInto(out *EditorModelRequest) { + *out = *in + out.ModelMetadata = in.ModelMetadata + if in.Values != nil { + in, out := &in.Values, &out.Values + *out = new(runtime.RawExtension) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EditorModelRequest. +func (in *EditorModelRequest) DeepCopy() *EditorModelRequest { + if in == nil { + return nil + } + out := new(EditorModelRequest) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *EditorModelResource) DeepCopyInto(out *EditorModelResource) { + *out = *in + if in.Data != nil { + in, out := &in.Data, &out.Data + *out = new(runtime.RawExtension) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EditorModelResource. +func (in *EditorModelResource) DeepCopy() *EditorModelResource { + if in == nil { + return nil + } + out := new(EditorModelResource) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *EditorModelResponse) DeepCopyInto(out *EditorModelResponse) { + *out = *in + if in.Values != nil { + in, out := &in.Values, &out.Values + *out = new(runtime.RawExtension) + (*in).DeepCopyInto(*out) + } + if in.Resources != nil { + in, out := &in.Resources, &out.Resources + *out = make([]EditorModelResource, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new EditorModelResponse. +func (in *EditorModelResponse) DeepCopy() *EditorModelResponse { + if in == nil { + return nil + } + out := new(EditorModelResponse) + in.DeepCopyInto(out) + return out +} diff --git a/vendor/kmodules.xyz/resource-metadata/apis/identity/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/identity/v1alpha1/openapi_generated.go index 42e142330..f5c96ed6f 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/identity/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/identity/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -2301,6 +2299,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2343,6 +2342,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7268,6 +7268,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7365,6 +7366,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7438,6 +7440,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7889,6 +7892,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8405,6 +8409,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9647,7 +9652,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11262,6 +11267,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12776,10 +12782,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12817,6 +12823,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19236,10 +19243,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { diff --git a/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/openapi_generated.go index 02f3e954a..24e04212c 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -2286,6 +2284,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2328,6 +2327,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7253,6 +7253,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7350,6 +7351,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7423,6 +7425,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7874,6 +7877,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8390,6 +8394,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9632,7 +9637,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11247,6 +11252,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12761,10 +12767,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12802,6 +12808,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19221,10 +19228,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { diff --git a/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/register.go b/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/register.go index 9daa32230..1eb2b6aaf 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/register.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/management/v1alpha1/register.go @@ -48,12 +48,14 @@ func Resource(resource string) schema.GroupResource { // Adds the list of known types to api.Scheme. func addKnownTypes(scheme *runtime.Scheme) error { - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &ProjectQuota{}, &ProjectQuotaList{}, ) - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &metav1.Status{}, ) metav1.AddToGroupVersion(scheme, SchemeGroupVersion) diff --git a/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/openapi_generated.go index a54d24cf3..c500d376e 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -2384,6 +2382,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2426,6 +2425,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7351,6 +7351,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7448,6 +7449,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7521,6 +7523,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7972,6 +7975,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8488,6 +8492,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9730,7 +9735,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11345,6 +11350,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12859,10 +12865,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12900,6 +12906,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19319,10 +19326,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -24463,12 +24470,14 @@ func schema_resource_metadata_apis_meta_v1alpha1_TableCell(ref common.ReferenceC "data": { SchemaProps: spec.SchemaProps{ Description: "cells will be as wide as the column definitions array and may contain strings, numbers (float64 or int64), booleans, simple maps, lists, or null. See the type field of the column definition for a more detailed description.", - Ref: ref("any"), + Type: []string{"object"}, + Format: "", }, }, "sort": { SchemaProps: spec.SchemaProps{ - Ref: ref("any"), + Type: []string{"object"}, + Format: "", }, }, "link": { @@ -24499,8 +24508,6 @@ func schema_resource_metadata_apis_meta_v1alpha1_TableCell(ref common.ReferenceC Required: []string{"data"}, }, }, - Dependencies: []string{ - "any"}, } } diff --git a/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/register.go b/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/register.go index 91f7a4d49..398005e93 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/register.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/meta/v1alpha1/register.go @@ -48,7 +48,8 @@ func Resource(resource string) schema.GroupResource { // Adds the list of known types to api.Scheme. func addKnownTypes(scheme *runtime.Scheme) error { - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &ChartPresetQuery{}, &ClusterProfile{}, &ClusterProfileList{}, @@ -82,7 +83,8 @@ func addKnownTypes(scheme *runtime.Scheme) error { &RenderDashboard{}, ) - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &metav1.Status{}, ) metav1.AddToGroupVersion(scheme, SchemeGroupVersion) diff --git a/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/openapi_generated.go index 514eaa9c9..a36f4f80e 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -2285,6 +2283,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2327,6 +2326,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7252,6 +7252,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7349,6 +7350,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7422,6 +7424,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7873,6 +7876,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8389,6 +8393,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9631,7 +9636,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11246,6 +11251,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12760,10 +12766,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12801,6 +12807,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19220,10 +19227,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { diff --git a/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/register.go b/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/register.go index 99334b821..5e9539c9a 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/register.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/node/v1alpha1/register.go @@ -48,12 +48,14 @@ func Resource(resource string) schema.GroupResource { // Adds the list of known types to api.Scheme. func addKnownTypes(scheme *runtime.Scheme) error { - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &NodeTopology{}, &NodeTopologyList{}, ) - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &metav1.Status{}, ) metav1.AddToGroupVersion(scheme, SchemeGroupVersion) diff --git a/vendor/kmodules.xyz/resource-metadata/apis/shared/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/shared/openapi_generated.go index 797151416..1af3f833a 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/shared/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/shared/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package shared import ( diff --git a/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/openapi_generated.go b/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/openapi_generated.go index 119fc62db..9db2c4ff9 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/openapi_generated.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/openapi_generated.go @@ -19,8 +19,6 @@ limitations under the License. // Code generated by openapi-gen. DO NOT EDIT. -// This file was autogenerated by openapi-gen. Do not edit it manually! - package v1alpha1 import ( @@ -2315,6 +2313,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRule(ref common.ReferenceCallback) }, }, }, + Required: []string{"action"}, }, }, Dependencies: []string{ @@ -2357,6 +2356,7 @@ func schema_k8sio_api_core_v1_ContainerRestartRuleOnExitCodes(ref common.Referen }, }, }, + Required: []string{"operator"}, }, }, } @@ -7282,6 +7282,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimSpec(ref common.ReferenceCall Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7379,6 +7380,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -7452,6 +7454,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeClaimStatus(ref common.ReferenceCa Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ControllerResizeInProgress", "ControllerResizeInfeasible", "NodeResizeInProgress", "NodeResizeInfeasible", "NodeResizePending"}, }, }, }, @@ -7903,6 +7906,7 @@ func schema_k8sio_api_core_v1_PersistentVolumeSpec(ref common.ReferenceCallback) Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"ReadOnlyMany", "ReadWriteMany", "ReadWriteOnce", "ReadWriteOncePod"}, }, }, }, @@ -8419,6 +8423,7 @@ func schema_k8sio_api_core_v1_PodCertificateProjection(ref common.ReferenceCallb }, }, }, + Required: []string{"signerName", "keyType"}, }, }, } @@ -9661,7 +9666,7 @@ func schema_k8sio_api_core_v1_PodSpec(ref common.ReferenceCallback) common.OpenA }, "setHostnameAsFQDN": { SchemaProps: spec.SchemaProps{ - Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\SYSTEM\\CurrentControlSet\\Services\\Tcpip\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", + Description: "If true the pod's hostname will be configured as the pod's FQDN, rather than the leaf name (the default). In Linux containers, this means setting the FQDN in the hostname field of the kernel (the nodename field of struct utsname). In Windows containers, this means setting the registry value of hostname for the registry key HKEY_LOCAL_MACHINE\\\\SYSTEM\\\\CurrentControlSet\\\\Services\\\\Tcpip\\\\Parameters to FQDN. If a pod does not have FQDN, this has no effect. Default to false.", Type: []string{"boolean"}, Format: "", }, @@ -11276,6 +11281,7 @@ func schema_k8sio_api_core_v1_ResourceQuotaSpec(ref common.ReferenceCallback) co Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"BestEffort", "CrossNamespacePodAffinity", "NotBestEffort", "NotTerminating", "PriorityClass", "Terminating", "VolumeAttributesClass"}, }, }, }, @@ -12790,10 +12796,10 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy describes how nodes distribute service traffic they receive on one of the Service's \"externally-facing\" addresses (NodePorts, ExternalIPs, and LoadBalancer IPs). If set to \"Local\", the proxy will configure the service in a way that assumes that external load balancers will take care of balancing the service traffic between nodes, and so each node will deliver traffic only to the node-local endpoints of the service, without masquerading the client source IP. (Traffic mistakenly sent to a node with no endpoints will be dropped.) The default value, \"Cluster\", uses the standard behavior of routing to all endpoints evenly (possibly modified by topology and other features). Note that traffic sent to an External IP or LoadBalancer IP from within the cluster will always get \"Cluster\" semantics, but clients sending to a NodePort from within the cluster may need to take traffic policy into account when picking a node.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { @@ -12831,6 +12837,7 @@ func schema_k8sio_api_core_v1_ServiceSpec(ref common.ReferenceCallback) common.O Default: "", Type: []string{"string"}, Format: "", + Enum: []interface{}{"", "IPv4", "IPv6"}, }, }, }, @@ -19250,10 +19257,10 @@ func schema_kmodulesxyz_offshoot_api_api_v1_ServiceSpec(ref common.ReferenceCall }, "externalTrafficPolicy": { SchemaProps: spec.SchemaProps{ - Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"`\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"`\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", + Description: "externalTrafficPolicy denotes if this Service desires to route external traffic to node-local or cluster-wide endpoints. \"Local\" preserves the client source IP and avoids a second hop for LoadBalancer and Nodeport type services, but risks potentially imbalanced traffic spreading. \"Cluster\" obscures the client source IP and may cause a second hop to another node, but should have good overall load-spreading.\n\nPossible enum values:\n - `\"Cluster\"` routes traffic to all endpoints.\n - `\"Local\"` preserves the source IP of the traffic by routing only to endpoints on the same node as the traffic was received on (dropping the traffic if there are no local endpoints).", Type: []string{"string"}, Format: "", - Enum: []interface{}{"Cluster", "Cluster", "Local", "Local"}, + Enum: []interface{}{"Cluster", "Local"}, }, }, "healthCheckNodePort": { diff --git a/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/register.go b/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/register.go index e83830dea..c3910863e 100644 --- a/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/register.go +++ b/vendor/kmodules.xyz/resource-metadata/apis/ui/v1alpha1/register.go @@ -48,7 +48,8 @@ func Resource(resource string) schema.GroupResource { // Adds the list of known types to api.Scheme. func addKnownTypes(scheme *runtime.Scheme) error { - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &ClusterProfile{}, &ClusterProfileList{}, &Feature{}, @@ -63,7 +64,8 @@ func addKnownTypes(scheme *runtime.Scheme) error { &ResourceOutlineFilterList{}, ) - scheme.AddKnownTypes(SchemeGroupVersion, + scheme.AddKnownTypes( + SchemeGroupVersion, &metav1.Status{}, ) metav1.AddToGroupVersion(scheme, SchemeGroupVersion) diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/scheme/register.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/scheme/register.go index 49bacd2fb..cda227a93 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/scheme/register.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/scheme/register.go @@ -19,17 +19,19 @@ limitations under the License. package scheme import ( - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - runtime "k8s.io/apimachinery/pkg/runtime" - schema "k8s.io/apimachinery/pkg/runtime/schema" - serializer "k8s.io/apimachinery/pkg/runtime/serializer" - utilruntime "k8s.io/apimachinery/pkg/util/runtime" corev1alpha1 "kmodules.xyz/resource-metadata/apis/core/v1alpha1" + editorv1alpha1 "kmodules.xyz/resource-metadata/apis/editor/v1alpha1" identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" managementv1alpha1 "kmodules.xyz/resource-metadata/apis/management/v1alpha1" metav1alpha1 "kmodules.xyz/resource-metadata/apis/meta/v1alpha1" nodev1alpha1 "kmodules.xyz/resource-metadata/apis/node/v1alpha1" uiv1alpha1 "kmodules.xyz/resource-metadata/apis/ui/v1alpha1" + + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + runtime "k8s.io/apimachinery/pkg/runtime" + schema "k8s.io/apimachinery/pkg/runtime/schema" + serializer "k8s.io/apimachinery/pkg/runtime/serializer" + utilruntime "k8s.io/apimachinery/pkg/util/runtime" ) var Scheme = runtime.NewScheme() @@ -37,6 +39,7 @@ var Codecs = serializer.NewCodecFactory(Scheme) var ParameterCodec = runtime.NewParameterCodec(Scheme) var localSchemeBuilder = runtime.SchemeBuilder{ corev1alpha1.AddToScheme, + editorv1alpha1.AddToScheme, identityv1alpha1.AddToScheme, managementv1alpha1.AddToScheme, metav1alpha1.AddToScheme, diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/audittokenrequest.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/audittokenrequest.go index 69614801e..09f07fd31 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/audittokenrequest.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/audittokenrequest.go @@ -19,12 +19,13 @@ limitations under the License. package v1alpha1 import ( - "context" + context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - rest "k8s.io/client-go/rest" - v1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" + identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" + + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + gentype "kmodules.xyz/client-go/gentype" ) // AuditTokenRequestsGetter has a method to return a AuditTokenRequestInterface. @@ -35,30 +36,24 @@ type AuditTokenRequestsGetter interface { // AuditTokenRequestInterface has methods to work with AuditTokenRequest resources. type AuditTokenRequestInterface interface { - Create(ctx context.Context, auditTokenRequest *v1alpha1.AuditTokenRequest, opts v1.CreateOptions) (*v1alpha1.AuditTokenRequest, error) + Create(ctx context.Context, auditTokenRequest *identityv1alpha1.AuditTokenRequest, opts v1.CreateOptions) (*identityv1alpha1.AuditTokenRequest, error) AuditTokenRequestExpansion } // auditTokenRequests implements AuditTokenRequestInterface type auditTokenRequests struct { - client rest.Interface + *gentype.Client[*identityv1alpha1.AuditTokenRequest] } // newAuditTokenRequests returns a AuditTokenRequests func newAuditTokenRequests(c *IdentityV1alpha1Client) *auditTokenRequests { return &auditTokenRequests{ - client: c.RESTClient(), + gentype.NewClient[*identityv1alpha1.AuditTokenRequest]( + "audittokenrequests", + c.RESTClient(), + scheme.ParameterCodec, + "", + func() *identityv1alpha1.AuditTokenRequest { return &identityv1alpha1.AuditTokenRequest{} }, + ), } } - -// Create takes the representation of a auditTokenRequest and creates it. Returns the server's representation of the auditTokenRequest, and an error, if there is any. -func (c *auditTokenRequests) Create(ctx context.Context, auditTokenRequest *v1alpha1.AuditTokenRequest, opts v1.CreateOptions) (result *v1alpha1.AuditTokenRequest, err error) { - result = &v1alpha1.AuditTokenRequest{} - err = c.client.Post(). - Resource("audittokenrequests"). - VersionedParams(&opts, scheme.ParameterCodec). - Body(auditTokenRequest). - Do(ctx). - Into(result) - return -} diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/clusteridentity.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/clusteridentity.go index 388680bc6..ffb13ed54 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/clusteridentity.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/clusteridentity.go @@ -19,15 +19,15 @@ limitations under the License. package v1alpha1 import ( - "context" - "time" + context "context" + + identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" + scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" v1 "k8s.io/apimachinery/pkg/apis/meta/v1" types "k8s.io/apimachinery/pkg/types" watch "k8s.io/apimachinery/pkg/watch" - rest "k8s.io/client-go/rest" - v1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" - scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" + gentype "k8s.io/client-go/gentype" ) // ClusterIdentitiesGetter has a method to return a ClusterIdentityInterface. @@ -38,158 +38,34 @@ type ClusterIdentitiesGetter interface { // ClusterIdentityInterface has methods to work with ClusterIdentity resources. type ClusterIdentityInterface interface { - Create(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.CreateOptions) (*v1alpha1.ClusterIdentity, error) - Update(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.UpdateOptions) (*v1alpha1.ClusterIdentity, error) - UpdateStatus(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.UpdateOptions) (*v1alpha1.ClusterIdentity, error) + Create(ctx context.Context, clusterIdentity *identityv1alpha1.ClusterIdentity, opts v1.CreateOptions) (*identityv1alpha1.ClusterIdentity, error) + Update(ctx context.Context, clusterIdentity *identityv1alpha1.ClusterIdentity, opts v1.UpdateOptions) (*identityv1alpha1.ClusterIdentity, error) + // Add a +genclient:noStatus comment above the type to avoid generating UpdateStatus(). + UpdateStatus(ctx context.Context, clusterIdentity *identityv1alpha1.ClusterIdentity, opts v1.UpdateOptions) (*identityv1alpha1.ClusterIdentity, error) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error - Get(ctx context.Context, name string, opts v1.GetOptions) (*v1alpha1.ClusterIdentity, error) - List(ctx context.Context, opts v1.ListOptions) (*v1alpha1.ClusterIdentityList, error) + Get(ctx context.Context, name string, opts v1.GetOptions) (*identityv1alpha1.ClusterIdentity, error) + List(ctx context.Context, opts v1.ListOptions) (*identityv1alpha1.ClusterIdentityList, error) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) - Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.ClusterIdentity, err error) + Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *identityv1alpha1.ClusterIdentity, err error) ClusterIdentityExpansion } // clusterIdentities implements ClusterIdentityInterface type clusterIdentities struct { - client rest.Interface - ns string + *gentype.ClientWithList[*identityv1alpha1.ClusterIdentity, *identityv1alpha1.ClusterIdentityList] } // newClusterIdentities returns a ClusterIdentities func newClusterIdentities(c *IdentityV1alpha1Client, namespace string) *clusterIdentities { return &clusterIdentities{ - client: c.RESTClient(), - ns: namespace, - } -} - -// Get takes name of the clusterIdentity, and returns the corresponding clusterIdentity object, and an error if there is any. -func (c *clusterIdentities) Get(ctx context.Context, name string, options v1.GetOptions) (result *v1alpha1.ClusterIdentity, err error) { - result = &v1alpha1.ClusterIdentity{} - err = c.client.Get(). - Namespace(c.ns). - Resource("clusteridentities"). - Name(name). - VersionedParams(&options, scheme.ParameterCodec). - Do(ctx). - Into(result) - return -} - -// List takes label and field selectors, and returns the list of ClusterIdentities that match those selectors. -func (c *clusterIdentities) List(ctx context.Context, opts v1.ListOptions) (result *v1alpha1.ClusterIdentityList, err error) { - var timeout time.Duration - if opts.TimeoutSeconds != nil { - timeout = time.Duration(*opts.TimeoutSeconds) * time.Second - } - result = &v1alpha1.ClusterIdentityList{} - err = c.client.Get(). - Namespace(c.ns). - Resource("clusteridentities"). - VersionedParams(&opts, scheme.ParameterCodec). - Timeout(timeout). - Do(ctx). - Into(result) - return -} - -// Watch returns a watch.Interface that watches the requested clusterIdentities. -func (c *clusterIdentities) Watch(ctx context.Context, opts v1.ListOptions) (watch.Interface, error) { - var timeout time.Duration - if opts.TimeoutSeconds != nil { - timeout = time.Duration(*opts.TimeoutSeconds) * time.Second - } - opts.Watch = true - return c.client.Get(). - Namespace(c.ns). - Resource("clusteridentities"). - VersionedParams(&opts, scheme.ParameterCodec). - Timeout(timeout). - Watch(ctx) -} - -// Create takes the representation of a clusterIdentity and creates it. Returns the server's representation of the clusterIdentity, and an error, if there is any. -func (c *clusterIdentities) Create(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.CreateOptions) (result *v1alpha1.ClusterIdentity, err error) { - result = &v1alpha1.ClusterIdentity{} - err = c.client.Post(). - Namespace(c.ns). - Resource("clusteridentities"). - VersionedParams(&opts, scheme.ParameterCodec). - Body(clusterIdentity). - Do(ctx). - Into(result) - return -} - -// Update takes the representation of a clusterIdentity and updates it. Returns the server's representation of the clusterIdentity, and an error, if there is any. -func (c *clusterIdentities) Update(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.UpdateOptions) (result *v1alpha1.ClusterIdentity, err error) { - result = &v1alpha1.ClusterIdentity{} - err = c.client.Put(). - Namespace(c.ns). - Resource("clusteridentities"). - Name(clusterIdentity.Name). - VersionedParams(&opts, scheme.ParameterCodec). - Body(clusterIdentity). - Do(ctx). - Into(result) - return -} - -// UpdateStatus was generated because the type contains a Status member. -// Add a +genclient:noStatus comment above the type to avoid generating UpdateStatus(). -func (c *clusterIdentities) UpdateStatus(ctx context.Context, clusterIdentity *v1alpha1.ClusterIdentity, opts v1.UpdateOptions) (result *v1alpha1.ClusterIdentity, err error) { - result = &v1alpha1.ClusterIdentity{} - err = c.client.Put(). - Namespace(c.ns). - Resource("clusteridentities"). - Name(clusterIdentity.Name). - SubResource("status"). - VersionedParams(&opts, scheme.ParameterCodec). - Body(clusterIdentity). - Do(ctx). - Into(result) - return -} - -// Delete takes name of the clusterIdentity and deletes it. Returns an error if one occurs. -func (c *clusterIdentities) Delete(ctx context.Context, name string, opts v1.DeleteOptions) error { - return c.client.Delete(). - Namespace(c.ns). - Resource("clusteridentities"). - Name(name). - Body(&opts). - Do(ctx). - Error() -} - -// DeleteCollection deletes a collection of objects. -func (c *clusterIdentities) DeleteCollection(ctx context.Context, opts v1.DeleteOptions, listOpts v1.ListOptions) error { - var timeout time.Duration - if listOpts.TimeoutSeconds != nil { - timeout = time.Duration(*listOpts.TimeoutSeconds) * time.Second + gentype.NewClientWithList[*identityv1alpha1.ClusterIdentity, *identityv1alpha1.ClusterIdentityList]( + "clusteridentities", + c.RESTClient(), + scheme.ParameterCodec, + namespace, + func() *identityv1alpha1.ClusterIdentity { return &identityv1alpha1.ClusterIdentity{} }, + func() *identityv1alpha1.ClusterIdentityList { return &identityv1alpha1.ClusterIdentityList{} }, + ), } - return c.client.Delete(). - Namespace(c.ns). - Resource("clusteridentities"). - VersionedParams(&listOpts, scheme.ParameterCodec). - Timeout(timeout). - Body(&opts). - Do(ctx). - Error() -} - -// Patch applies the patch and returns the patched clusterIdentity. -func (c *clusterIdentities) Patch(ctx context.Context, name string, pt types.PatchType, data []byte, opts v1.PatchOptions, subresources ...string) (result *v1alpha1.ClusterIdentity, err error) { - result = &v1alpha1.ClusterIdentity{} - err = c.client.Patch(pt). - Namespace(c.ns). - Resource("clusteridentities"). - Name(name). - SubResource(subresources...). - VersionedParams(&opts, scheme.ParameterCodec). - Body(data). - Do(ctx). - Into(result) - return } diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/identity_client.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/identity_client.go index d83e8bb65..8e8a596cf 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/identity_client.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/identity_client.go @@ -19,11 +19,12 @@ limitations under the License. package v1alpha1 import ( - "net/http" + http "net/http" + + identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" + scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" rest "k8s.io/client-go/rest" - v1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" - "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" ) type IdentityV1alpha1Interface interface { @@ -60,9 +61,7 @@ func (c *IdentityV1alpha1Client) SelfSubjectNamespaceAccessReviews() SelfSubject // where httpClient was generated with rest.HTTPClientFor(c). func NewForConfig(c *rest.Config) (*IdentityV1alpha1Client, error) { config := *c - if err := setConfigDefaults(&config); err != nil { - return nil, err - } + setConfigDefaults(&config) httpClient, err := rest.HTTPClientFor(&config) if err != nil { return nil, err @@ -74,9 +73,7 @@ func NewForConfig(c *rest.Config) (*IdentityV1alpha1Client, error) { // Note the http client provided takes precedence over the configured transport values. func NewForConfigAndClient(c *rest.Config, h *http.Client) (*IdentityV1alpha1Client, error) { config := *c - if err := setConfigDefaults(&config); err != nil { - return nil, err - } + setConfigDefaults(&config) client, err := rest.RESTClientForConfigAndClient(&config, h) if err != nil { return nil, err @@ -99,17 +96,15 @@ func New(c rest.Interface) *IdentityV1alpha1Client { return &IdentityV1alpha1Client{c} } -func setConfigDefaults(config *rest.Config) error { - gv := v1alpha1.SchemeGroupVersion +func setConfigDefaults(config *rest.Config) { + gv := identityv1alpha1.SchemeGroupVersion config.GroupVersion = &gv config.APIPath = "/apis" - config.NegotiatedSerializer = scheme.Codecs.WithoutConversion() + config.NegotiatedSerializer = rest.CodecFactoryForGeneratedClient(scheme.Scheme, scheme.Codecs).WithoutConversion() if config.UserAgent == "" { config.UserAgent = rest.DefaultKubernetesUserAgent() } - - return nil } // RESTClient returns a RESTClient that is used to communicate diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/inboxtokenrequest.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/inboxtokenrequest.go index 1e27b0b0d..ab6ab8be6 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/inboxtokenrequest.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/inboxtokenrequest.go @@ -19,12 +19,13 @@ limitations under the License. package v1alpha1 import ( - "context" + context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - rest "k8s.io/client-go/rest" - v1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" + identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" + + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + gentype "kmodules.xyz/client-go/gentype" ) // InboxTokenRequestsGetter has a method to return a InboxTokenRequestInterface. @@ -35,30 +36,24 @@ type InboxTokenRequestsGetter interface { // InboxTokenRequestInterface has methods to work with InboxTokenRequest resources. type InboxTokenRequestInterface interface { - Create(ctx context.Context, inboxTokenRequest *v1alpha1.InboxTokenRequest, opts v1.CreateOptions) (*v1alpha1.InboxTokenRequest, error) + Create(ctx context.Context, inboxTokenRequest *identityv1alpha1.InboxTokenRequest, opts v1.CreateOptions) (*identityv1alpha1.InboxTokenRequest, error) InboxTokenRequestExpansion } // inboxTokenRequests implements InboxTokenRequestInterface type inboxTokenRequests struct { - client rest.Interface + *gentype.Client[*identityv1alpha1.InboxTokenRequest] } // newInboxTokenRequests returns a InboxTokenRequests func newInboxTokenRequests(c *IdentityV1alpha1Client) *inboxTokenRequests { return &inboxTokenRequests{ - client: c.RESTClient(), + gentype.NewClient[*identityv1alpha1.InboxTokenRequest]( + "inboxtokenrequests", + c.RESTClient(), + scheme.ParameterCodec, + "", + func() *identityv1alpha1.InboxTokenRequest { return &identityv1alpha1.InboxTokenRequest{} }, + ), } } - -// Create takes the representation of a inboxTokenRequest and creates it. Returns the server's representation of the inboxTokenRequest, and an error, if there is any. -func (c *inboxTokenRequests) Create(ctx context.Context, inboxTokenRequest *v1alpha1.InboxTokenRequest, opts v1.CreateOptions) (result *v1alpha1.InboxTokenRequest, err error) { - result = &v1alpha1.InboxTokenRequest{} - err = c.client.Post(). - Resource("inboxtokenrequests"). - VersionedParams(&opts, scheme.ParameterCodec). - Body(inboxTokenRequest). - Do(ctx). - Into(result) - return -} diff --git a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/selfsubjectnamespaceaccessreview.go b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/selfsubjectnamespaceaccessreview.go index 377532640..886d145ed 100644 --- a/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/selfsubjectnamespaceaccessreview.go +++ b/vendor/kmodules.xyz/resource-metadata/client/clientset/versioned/typed/identity/v1alpha1/selfsubjectnamespaceaccessreview.go @@ -19,12 +19,13 @@ limitations under the License. package v1alpha1 import ( - "context" + context "context" - v1 "k8s.io/apimachinery/pkg/apis/meta/v1" - rest "k8s.io/client-go/rest" - v1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" + identityv1alpha1 "kmodules.xyz/resource-metadata/apis/identity/v1alpha1" scheme "kmodules.xyz/resource-metadata/client/clientset/versioned/scheme" + + v1 "k8s.io/apimachinery/pkg/apis/meta/v1" + gentype "k8s.io/client-go/gentype" ) // SelfSubjectNamespaceAccessReviewsGetter has a method to return a SelfSubjectNamespaceAccessReviewInterface. @@ -35,30 +36,26 @@ type SelfSubjectNamespaceAccessReviewsGetter interface { // SelfSubjectNamespaceAccessReviewInterface has methods to work with SelfSubjectNamespaceAccessReview resources. type SelfSubjectNamespaceAccessReviewInterface interface { - Create(ctx context.Context, selfSubjectNamespaceAccessReview *v1alpha1.SelfSubjectNamespaceAccessReview, opts v1.CreateOptions) (*v1alpha1.SelfSubjectNamespaceAccessReview, error) + Create(ctx context.Context, selfSubjectNamespaceAccessReview *identityv1alpha1.SelfSubjectNamespaceAccessReview, opts v1.CreateOptions) (*identityv1alpha1.SelfSubjectNamespaceAccessReview, error) SelfSubjectNamespaceAccessReviewExpansion } // selfSubjectNamespaceAccessReviews implements SelfSubjectNamespaceAccessReviewInterface type selfSubjectNamespaceAccessReviews struct { - client rest.Interface + *gentype.Client[*identityv1alpha1.SelfSubjectNamespaceAccessReview] } // newSelfSubjectNamespaceAccessReviews returns a SelfSubjectNamespaceAccessReviews func newSelfSubjectNamespaceAccessReviews(c *IdentityV1alpha1Client) *selfSubjectNamespaceAccessReviews { return &selfSubjectNamespaceAccessReviews{ - client: c.RESTClient(), + gentype.NewClient[*identityv1alpha1.SelfSubjectNamespaceAccessReview]( + "selfsubjectnamespaceaccessreviews", + c.RESTClient(), + scheme.ParameterCodec, + "", + func() *identityv1alpha1.SelfSubjectNamespaceAccessReview { + return &identityv1alpha1.SelfSubjectNamespaceAccessReview{} + }, + ), } } - -// Create takes the representation of a selfSubjectNamespaceAccessReview and creates it. Returns the server's representation of the selfSubjectNamespaceAccessReview, and an error, if there is any. -func (c *selfSubjectNamespaceAccessReviews) Create(ctx context.Context, selfSubjectNamespaceAccessReview *v1alpha1.SelfSubjectNamespaceAccessReview, opts v1.CreateOptions) (result *v1alpha1.SelfSubjectNamespaceAccessReview, err error) { - result = &v1alpha1.SelfSubjectNamespaceAccessReview{} - err = c.client.Post(). - Resource("selfsubjectnamespaceaccessreviews"). - VersionedParams(&opts, scheme.ParameterCodec). - Body(selfSubjectNamespaceAccessReview). - Do(ctx). - Into(result) - return -} diff --git a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresources.yaml b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresources.yaml index d0add687e..b90edc958 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresources.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresources.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: genericresources.core.k8s.appscode.com spec: group: core.k8s.appscode.com @@ -125,10 +124,14 @@ spec: namespace: properties: aceOrgID: + description: 'Deprecated: use GenericResourceSpec.Tenant. Removed + after one release.' type: string aceOrgMetadata: additionalProperties: type: string + description: 'Deprecated: use GenericResourceSpec.Tenant. Removed + after one release.' type: object creationTimestamp: format: date-time @@ -390,6 +393,23 @@ spec: - name type: object type: array + tenant: + description: |- + TenantInfo identifies the org a usage event is billed to, independent of how + that org was discovered. + properties: + metadata: + additionalProperties: + type: string + type: object + orgID: + type: string + source: + enum: + - namespace + - cluster + type: string + type: object totalResource: properties: limits: diff --git a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresourceservices.yaml b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresourceservices.yaml index df21f7503..38adc59c3 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresourceservices.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_genericresourceservices.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: genericresourceservices.core.k8s.appscode.com spec: group: core.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_podviews.yaml b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_podviews.yaml index 294d4f84f..26bdf2c2d 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_podviews.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_podviews.yaml @@ -1,7 +1,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: podviews.core.k8s.appscode.com spec: group: core.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_projects.yaml b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_projects.yaml index 2a4fd5cb7..c3874197b 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_projects.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_projects.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: projects.core.k8s.appscode.com spec: group: core.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_resourcesummaries.yaml b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_resourcesummaries.yaml index 9246ea71f..0fca07968 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_resourcesummaries.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/core.k8s.appscode.com_resourcesummaries.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcesummaries.core.k8s.appscode.com spec: group: core.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_clusteridentitys.yaml b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_clusteridentitys.yaml index 6d40bd273..a8f6cf154 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_clusteridentitys.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_clusteridentitys.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: clusteridentitys.identity.k8s.appscode.com spec: group: identity.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_selfsubjectnamespaceaccessreviews.yaml b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_selfsubjectnamespaceaccessreviews.yaml index 49cc570d4..043f0d3d3 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_selfsubjectnamespaceaccessreviews.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_selfsubjectnamespaceaccessreviews.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: selfsubjectnamespaceaccessreviews.identity.k8s.appscode.com spec: group: identity.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_siteinfos.yaml b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_siteinfos.yaml index 54a920d3b..541161f23 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_siteinfos.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/identity.k8s.appscode.com_siteinfos.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: siteinfos.identity.k8s.appscode.com spec: group: identity.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/management.k8s.appscode.com_projectquotas.yaml b/vendor/kmodules.xyz/resource-metadata/crds/management.k8s.appscode.com_projectquotas.yaml index 1e5b77f3e..3d9e820d4 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/management.k8s.appscode.com_projectquotas.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/management.k8s.appscode.com_projectquotas.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: projectquotas.management.k8s.appscode.com spec: group: management.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_clusterprofiles.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_clusterprofiles.yaml index 2ebc1acd2..08b61ef69 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_clusterprofiles.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_clusterprofiles.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: clusterprofiles.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_gatewayinfoes.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_gatewayinfoes.yaml index 53ce236f4..4e048f7c4 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_gatewayinfoes.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_gatewayinfoes.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: gatewayinfoes.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menuoutlines.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menuoutlines.yaml index 14567955c..10811c877 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menuoutlines.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menuoutlines.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: menuoutlines.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menus.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menus.yaml index 81621da2b..75c3af75c 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menus.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_menus.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: menus.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceblockdefinitions.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceblockdefinitions.yaml index 287d695ff..c37bb6637 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceblockdefinitions.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceblockdefinitions.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceblockdefinitions.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcecalculators.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcecalculators.yaml index b33f5e720..3f66b78b4 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcecalculators.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcecalculators.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcecalculators.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcedescriptors.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcedescriptors.yaml index bad892608..e016d5c35 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcedescriptors.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcedescriptors.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcedescriptors.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceeditors.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceeditors.yaml index 89d78723c..2de052c32 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceeditors.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceeditors.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceeditors.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcelayouts.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcelayouts.yaml index 93e48e331..4e52974c6 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcelayouts.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcelayouts.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcelayouts.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlinefilters.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlinefilters.yaml index 8dfc625c5..1d778f437 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlinefilters.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlinefilters.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceoutlinefilters.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlines.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlines.yaml index a64c233f8..511003b6b 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlines.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourceoutlines.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceoutlines.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcetabledefinitions.yaml b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcetabledefinitions.yaml index 10c22e475..0c0aff326 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcetabledefinitions.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/meta.k8s.appscode.com_resourcetabledefinitions.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcetabledefinitions.meta.k8s.appscode.com spec: group: meta.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/node.k8s.appscode.com_nodetopologies.yaml b/vendor/kmodules.xyz/resource-metadata/crds/node.k8s.appscode.com_nodetopologies.yaml index b29177ad7..82a4aa01b 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/node.k8s.appscode.com_nodetopologies.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/node.k8s.appscode.com_nodetopologies.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: nodetopologies.node.k8s.appscode.com spec: group: node.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_clusterprofiles.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_clusterprofiles.yaml index 4e25e4ca9..dbb6c855f 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_clusterprofiles.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_clusterprofiles.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: clusterprofiles.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_features.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_features.yaml index 1b502ecea..5a047e337 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_features.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_features.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: features.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_featuresets.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_featuresets.yaml index 9b845c127..315cd0914 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_featuresets.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_featuresets.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: featuresets.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourcedashboards.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourcedashboards.yaml index 4bb43b21c..5ec015982 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourcedashboards.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourcedashboards.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourcedashboards.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceeditors.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceeditors.yaml index da3db749d..10c102e7d 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceeditors.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceeditors.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceeditors.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceoutlinefilters.yaml b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceoutlinefilters.yaml index 1c95d4bdf..a10373b0e 100644 --- a/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceoutlinefilters.yaml +++ b/vendor/kmodules.xyz/resource-metadata/crds/ui.k8s.appscode.com_resourceoutlinefilters.yaml @@ -3,7 +3,6 @@ apiVersion: apiextensions.k8s.io/v1 kind: CustomResourceDefinition metadata: - creationTimestamp: null name: resourceoutlinefilters.ui.k8s.appscode.com spec: group: ui.k8s.appscode.com diff --git a/vendor/modules.txt b/vendor/modules.txt index 4d47fa08f..ab7c33be6 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -376,7 +376,7 @@ go.yaml.in/yaml/v2 # go.yaml.in/yaml/v3 v3.0.4 ## explicit; go 1.16 go.yaml.in/yaml/v3 -# golang.org/x/crypto v0.52.0 +# golang.org/x/crypto v0.55.0 ## explicit; go 1.25.0 golang.org/x/crypto/bcrypt golang.org/x/crypto/blake2b @@ -389,7 +389,7 @@ golang.org/x/crypto/nacl/secretbox golang.org/x/crypto/pbkdf2 golang.org/x/crypto/salsa20/salsa golang.org/x/crypto/scrypt -# golang.org/x/net v0.55.0 +# golang.org/x/net v0.57.0 ## explicit; go 1.25.0 golang.org/x/net/http/httpguts golang.org/x/net/http2 @@ -399,23 +399,23 @@ golang.org/x/net/internal/httpcommon golang.org/x/net/internal/httpsfv golang.org/x/net/internal/socks golang.org/x/net/proxy -# golang.org/x/oauth2 v0.33.0 -## explicit; go 1.24.0 +# golang.org/x/oauth2 v0.36.0 +## explicit; go 1.25.0 golang.org/x/oauth2 golang.org/x/oauth2/internal -# golang.org/x/sync v0.20.0 +# golang.org/x/sync v0.22.0 ## explicit; go 1.25.0 golang.org/x/sync/errgroup -# golang.org/x/sys v0.45.0 +# golang.org/x/sys v0.47.0 ## explicit; go 1.25.0 golang.org/x/sys/cpu golang.org/x/sys/plan9 golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/term v0.43.0 +# golang.org/x/term v0.45.0 ## explicit; go 1.25.0 golang.org/x/term -# golang.org/x/text v0.37.0 +# golang.org/x/text v0.41.0 ## explicit; go 1.25.0 golang.org/x/text/cases golang.org/x/text/internal @@ -446,10 +446,10 @@ gomodules.xyz/mergo # gomodules.xyz/pointer v0.1.0 ## explicit; go 1.15 gomodules.xyz/pointer -# gomodules.xyz/x v0.0.17 -## explicit; go 1.22.0 +# gomodules.xyz/x v0.0.18 +## explicit; go 1.25.0 gomodules.xyz/x/version -# google.golang.org/protobuf v1.36.10 +# google.golang.org/protobuf v1.36.11 ## explicit; go 1.23 google.golang.org/protobuf/encoding/protodelim google.golang.org/protobuf/encoding/prototext @@ -948,8 +948,8 @@ k8s.io/utils/trace # kmodules.xyz/apiversion v0.2.0 ## explicit; go 1.14 kmodules.xyz/apiversion -# kmodules.xyz/client-go v0.34.3 -## explicit; go 1.24.0 +# kmodules.xyz/client-go v0.34.7-0.20260916091548-45e2a0e7782d +## explicit; go 1.25.0 kmodules.xyz/client-go kmodules.xyz/client-go/api/v1 kmodules.xyz/client-go/apiextensions @@ -960,6 +960,7 @@ kmodules.xyz/client-go/cluster kmodules.xyz/client-go/core/v1 kmodules.xyz/client-go/discovery kmodules.xyz/client-go/dynamic +kmodules.xyz/client-go/gentype kmodules.xyz/client-go/meta kmodules.xyz/client-go/tools/clusterid # kmodules.xyz/go-containerregistry v0.0.15 @@ -969,9 +970,11 @@ kmodules.xyz/go-containerregistry/name ## explicit; go 1.24.0 kmodules.xyz/offshoot-api/api/v1 kmodules.xyz/offshoot-api/api/v2 -# kmodules.xyz/resource-metadata v0.46.1 +# kmodules.xyz/resource-metadata v0.49.1-0.20260916091615-a7e699f904a2 ## explicit; go 1.25.0 kmodules.xyz/resource-metadata/apis/core/v1alpha1 +kmodules.xyz/resource-metadata/apis/editor +kmodules.xyz/resource-metadata/apis/editor/v1alpha1 kmodules.xyz/resource-metadata/apis/identity/v1alpha1 kmodules.xyz/resource-metadata/apis/management kmodules.xyz/resource-metadata/apis/management/v1alpha1